[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rpal2:ABE38782.1"

            "cyclohex-1-ene 1-carbonyl-CoA hydratase"
            ""

OrgPattern 33-1--5976877876-121211963331348-----------------------------2331-11 26458325113332KYNDD-DO44PaEDEEEMURXRGQlq3T5N212512126554351188H1ACHD798--------1419-----1111-1211--31322254322--------------11111121112145554---3821121111111111111111-112111111111111154422---7535555544646464443855346645B974411111119-111111111111111111111-1----1-----11---1-111111---11111111111111111111111111111111--111---1--1331111111212-2221221-2-1-3-11-561426-15---1--2-4--DBBG-----41VKL425PHPMF67766674777-33834F49ACT-9442658A8ACA598E88BB47889AG--------611-1CB4-----------------------------1BGVB-4dRFRCGHGQB89998CCGEBBBA6AKBZLceY22DD7B67BAECHHOU2291---64----------JAA4U9B1---------16862E13--4434B633---------------------------561682B39646666647966668697689---1111------42352447556765688-587865576756566766755533444454444444444444464545555--433333333333---4222222222-4935222111111112111CCB8C4978761BA9A6967587886556----------232622222464445555555555------11555533-----------------------------------------------11 ----655-643-546C664878885867767466666A67776767558C99D9574354443-1------1----1111---------5C364643322328656-877GGE7BB97685AA5ND5E4X*J-TCI6364B87D946974B73E58BAHCID6F944B79EBB994442b3435689AH5676774445 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MPENVIIVEREGRVGIVTLNRPEVLNALNDELMDALGAALLAFDADDGIGAIVIAGTARA:Sequence :ccccEEEEcGGGcEEEEEEccGGGTTcccHHHHHHHHHHHHHHHHcTTccEEEEEccccE:Sec Str : XXXXXXXXXXXXXXXXXXXXXXXXXXXXX:SEG|32->71|lmdalgaallafdaddgigaiviagtarafaagadiagma : ===================================================:RP:SCP|10->255|1uiyA|2e-50|29.0|245/253|c.14.1.3 :============================================================:BL:SWS|1->258|ECHH_RHIME|7e-60|46.3|257/257 61: . . . * . .: 120 :FAAGADIAGMAEWSYSDVYSSNFITRNWETIKRVRKPVLASVAGLAFGGGCELALACDII:Sequence :EEccccHHHHTTccHHHHHHTTTHTTTTTGGGGccccEEEEEccEEETHHHHHHHHccEE:Sec Str :XXXXXXXXXXX :SEG|32->71|lmdalgaallafdaddgigaiviagtarafaagadiagma : ##################### :PROS|99->119|PS00166|ENOYL_COA_HYDRATASE|PDOC00150| :============================================================:RP:SCP|10->255|1uiyA|2e-50|29.0|245/253|c.14.1.3 :============================================================:BL:SWS|1->258|ECHH_RHIME|7e-60|46.3|257/257 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|84->181|PF00378|4e-22|58.2|98/170|ECH 121: . . + . . .: 180 :VAARSAKFALPEIKLGLLPGAGGTQRLPRAIGKAKAMDMCLSARPLDAEEADRYGLVSRV:Sequence :EEETTcEEEcGGGGGTccccccTTTHHHHHHcHHHHHHHHHHcccEEHHHHHHHTcccEE:Sec Str :============================================================:RP:SCP|10->255|1uiyA|2e-50|29.0|245/253|c.14.1.3 :============================================================:BL:SWS|1->258|ECHH_RHIME|7e-60|46.3|257/257 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|84->181|PF00378|4e-22|58.2|98/170|ECH 181: . * . . . .: 240 :VDDDRLREETMKLATTIASFSAPALMALKESLNRAFEIPLAEGILFERRELHARFATADA:Sequence :EcTTTHHHHHHHHHHHHHHccHHHHHHHHHHHHGGGTccHHHHHHHHHHHHHHHTTcHHH:Sec Str :============================================================:RP:SCP|10->255|1uiyA|2e-50|29.0|245/253|c.14.1.3 :============================================================:BL:SWS|1->258|ECHH_RHIME|7e-60|46.3|257/257 :$ :RP:PFM|84->181|PF00378|4e-22|58.2|98/170|ECH 241: + . . . . *: 300 :REGIRAFLEKRKPSFVHR :Sequence :HHHHHHHHTTcccccHHH :Sec Str :=============== :RP:SCP|10->255|1uiyA|2e-50|29.0|245/253|c.14.1.3 :================== :BL:SWS|1->258|ECHH_RHIME|7e-60|46.3|257/257