[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rpal2:ABE38828.1"

            "Methionine synthase, vitamin-B12 independent"
            ""

OrgPattern ---------------1-1------1----1-------------------------------------- --1--------------------------------------------------------------11----1------1---2-----11------------------------------2222---------------11----1---------------------------------------------1-1---------------1-1112-------1--111111--1--------------1--11111111121-1222211-11222111-------111------------------------11133-111-----2------------22-------12-11--1---------------1--------------111--111111--------------------1------------------------------------------------------------------------------------------------------------------------------1-1-----------------------------------------------------------1-----------------------------------------------------------------1132-11------------------------------11111-------------------1-------------------------------------1-2222-1--------------------------------------------------------------------------------------------------------------------------------------- -------------1-532211111313----------11111111122112222--222222---------------------------38-3121----2-1-------1------------------------------------------------------------------------------2--------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MQRTKAPFRADEVGSLLRPQSIKDARARLEKGEISAADLRRIEDMEIEKIVHKQSAIGLK:Sequence : ccccccccccccccHHHHHHHHHHHTTcccHHHHHHHHHHHHHHHHHHHHHHTcc:Sec Str : ===================================================:RP:SCP|10->371|1u1hA1|4e-50|16.0|332/394|c.1.22.2 :============================================================:BL:SWS|1->370|YXJG_BACSU|e-117|54.8|365/378 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|13->343|PF01717|4e-38|37.8|299/323|Meth_synt_2 61: . . . * . .: 120 :LATDGEFRRSWWHFDFLSHLTGCELYHPDTGIQFAGVQTRNDSIRVIGKLDFPDDHPMLE:Sequence :ccccccTTcccTTHHHHTTcEEEEccccccEEEETTEEEcccEccEEEEEEcccccccHH:Sec Str :============================================================:RP:SCP|10->371|1u1hA1|4e-50|16.0|332/394|c.1.22.2 :============================================================:BL:SWS|1->370|YXJG_BACSU|e-117|54.8|365/378 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|13->343|PF01717|4e-38|37.8|299/323|Meth_synt_2 121: . . + . . .: 180 :HFRFLKRHADIAHVTAKMTIPSPAVLHFRGGRKAISSEVYPDLDGFFEDLARTYRKAVKA:Sequence :HHHHHHTTccTTTccccEEEEcHHHHHHTcEEcccccccHHHHHHHHHHHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|10->371|1u1hA1|4e-50|16.0|332/394|c.1.22.2 :============================================================:BL:SWS|1->370|YXJG_BACSU|e-117|54.8|365/378 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|13->343|PF01717|4e-38|37.8|299/323|Meth_synt_2 181: . * . . . .: 240 :FYDAGCRYLQFDDTVWAYLCSQDELQKARERGDNPDNLQQIYSRVINYAIAERPSDMVIT:Sequence :HHHTTccEEEEEcTHHHHTccHHHHHHHHccGGGHHHHHHHHHHHHHHHTcccTTTcEEE:Sec Str :============================================================:RP:SCP|10->371|1u1hA1|4e-50|16.0|332/394|c.1.22.2 :============================================================:BL:SWS|1->370|YXJG_BACSU|e-117|54.8|365/378 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|13->343|PF01717|4e-38|37.8|299/323|Meth_synt_2 241: + . . . . *: 300 :THVCRGNFRSTWISSGGYEPVAETLLAGINYDGYFLEYDSERAGGFEPLRFLPKGNKVVV:Sequence :EEcccccc cccTTTHHHHTTTccccEEEEccTTTTTGGGHHHHTcTTcccEEE:Sec Str :============================================================:RP:SCP|10->371|1u1hA1|4e-50|16.0|332/394|c.1.22.2 :============================================================:BL:SWS|1->370|YXJG_BACSU|e-117|54.8|365/378 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|13->343|PF01717|4e-38|37.8|299/323|Meth_synt_2 301: . . . . + .: 360 :VGVITSKFGELEKKDDIKRRLDEAAKFAPLAQLALSPQCGFASTEEGNILSEQEQWDKLR:Sequence :EEcccTTccccccHHHHHHHHHHHTTTccGGGEEEEcccccTTcccc ccHHHHHHHHH:Sec Str :============================================================:RP:SCP|10->371|1u1hA1|4e-50|16.0|332/394|c.1.22.2 :============================================================:BL:SWS|1->370|YXJG_BACSU|e-117|54.8|365/378 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|13->343|PF01717|4e-38|37.8|299/323|Meth_synt_2 361: . . . * . .: 420 :LAVEVAQDVWGR :Sequence :HHHHHHHHHHc :Sec Str :=========== :RP:SCP|10->371|1u1hA1|4e-50|16.0|332/394|c.1.22.2 :========== :BL:SWS|1->370|YXJG_BACSU|e-117|54.8|365/378