[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rpal2:ABE39144.1"

            "conserved hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKREASGRSALIFAIALCACFSGPMLPAAGVAAPAASQDAASPAAKKKTVNAHTPQKPPP:Sequence : XXXXXXXXXXXXXXXXXXX :SEG|27->45|paagvaapaasqdaaspaa : XXXXXXXXX:SEG|52->71|ahtpqkpppakptaektkda 61: . . . * . .: 120 :AKPTAEKTKDASRLDSVATTPAEVTPEGAIETTAPTAIAPPSAALAPSIANANAQFPPVT:Sequence :XXXXXXXXXXX :SEG|52->71|ahtpqkpppakptaektkda : XXXXXXXXXXXXXXXXXXXXXXXXXXXXXX :SEG|85->114|tpegaiettaptaiappsaalapsianana 121: . . + . . .: 180 :HDAASSDAIVSQATPDPSRAHQTADDRHVVAPDEVNELDRAAGDTPPPAVMAASTTEPTI:Sequence : XXXXXXXXX:SEG|172->191|aastteptiaapapttvgaa 181: . * . . . .: 240 :AAPAPTTVGAAQVSSATSNDGAWDKASLIGKIFIAAGGLLTLASAARMFMA :Sequence :XXXXXXXXXXX :SEG|172->191|aastteptiaapapttvgaa : XXXXXXXXXXXX :SEG|215->226|aagglltlasaa