[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rpal2:ABE39178.1"

            "conserved hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MFFLLRLTFWLGLVLVLLPREKTPDSEKLPQIGASEAVSAASAAVSDFSQFCKRQPSACE:Sequence : XXXXXXXXXXXXXXXXX :SEG|2->18|ffllrltfwlglvlvll : XXXXXXXXXXXXX :SEG|34->46|aseavsaasaavs : ============:BL:SWS|49->84|Y1001_RHIME|1e-04|41.7|36/100 61: . . . * . .: 120 :IGEHAATVIGHRAQEGARKIYKIIIDKRSSDQTGSIDGVEGVDEQLIGYAPRDTLNPDDV:Sequence :======================== :BL:SWS|49->84|Y1001_RHIME|1e-04|41.7|36/100 121: . . + . . .: 180 :KVEWRLRGSETAAN :Sequence