[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rpal2:ABE39192.1"

            "conserved hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MFALARLAARVAAAAMLSVPAVAQAQTASEAGTAKPKPSAASQAKPATAADPKAAPKKEP:Sequence : XXXXXXXXXXXXXXXXXXXXXXX :SEG|3->25|alarlaarvaaaamlsvpavaqa : XXXXXXXXXXXXXXXXXXXXXXXXXXXX:SEG|33->61|takpkpsaasqakpataadpkaapkkepk 61: . . . * . .: 120 :KTMTRRQEIEHAIDTRTVPSRYRSSVPKEYQKYIPFAK :Sequence :X :SEG|33->61|takpkpsaasqakpataadpkaapkkepk