[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rpal2:ABE39200.1"

            "Excinuclease ABC, C subunit-like"
            ""

OrgPattern -------------------------------------------------------------------- 1----------------------------------------------------------------------------------------------------111-----1---------------1---11---1-1--1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-----------------------1--------------------------5332-------323212432-8------------------1-125-1---1-1-11-2-24-6-----------------------1----------------22--41-----1-1--7554-----------------------------------------------------------1-22-22-1-------2-------------------------------------------------------------1---------------2----1------1----------------------------------------------------------------------------------------------411111-B42-------------------------------------------------211-11111-------------11-------------------------------------------------------------1---------1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSRSYDVYILASRYRGTLYVGVTNDLPRRIAEHKAGAADGFTKKYNIKILVHVEEYSSIL:Sequence : ccEEEEEEEcT TcccEEEEEccHHHHHHHHHHHHcccccccccccEEEEEEEEccHH:Sec Str : ======================================================:RP:SCP|7->94|1ln0A|9e-15|12.5|88/92|d.226.1.1 :============================================================:BL:SWS|1->83|Y2523_STAHJ|5e-09|38.3|81/82 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|7->69|PF01541|1e-04|37.1|62/80|GIY-YIG 61: . . . * . .: 120 :EARTREHVLKRWRRDWKIALIEKLNPDWRDLSNDL :Sequence :HHHHHHHHHHHccHHHHHHHH :Sec Str :================================== :RP:SCP|7->94|1ln0A|9e-15|12.5|88/92|d.226.1.1 :======================= :BL:SWS|1->83|Y2523_STAHJ|5e-09|38.3|81/82 :$$$$$$$$$ :RP:PFM|7->69|PF01541|1e-04|37.1|62/80|GIY-YIG