[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABE39200.1 rpal2 ABE39200.1 "Excinuclease ABC, C subunit-like"
MSRSYDVYILASRYRGTLYVGVTNDLPRRIAEHKAGAADGFTKKYNIKILVHVEEYSSIL
EARTREHVLKRWRRDWKIALIEKLNPDWRDLSNDL
//