[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rpal2:ABE39202.1"

            "conserved hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSDLIKIFTERGDLAHLALLLWACAASAGLWFSLREMAAASRRFDDFVHALELFNRRARR:Sequence : XXXXXXXXXXXXXXXXX :SEG|14->30|lahlalllwacaasagl : XXXXX:SEG|56->63|rrarrrra 61: . . . * . .: 120 :RRAPDEIGRDHD :Sequence :XXX :SEG|56->63|rrarrrra