[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rpal2:ABE39203.1"

            "hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MDRLHQVLSAIRTETKSAKNPASVFREFLSHVDQAQRKPPAKRPRLKAAAPRRRAAKRTK:Sequence : XXXXXXXXXXXXXXXXXXXXXXXX :SEG|35->58|aqrkppakrprlkaaaprrraakr