[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rpal2:ABE39205.1"

            "phage major capsid protein, HK97"
            ""

OrgPattern -------------------------------------------------------------------- --------------------------------1----2---------------------------------------------------------------------------------------------------------1--------------------------------------------------------1--1---1-----------------------------------------------------1------------------1-----------------------1-------------------1-------------1-22------1-----2------1----1---------111-----------54211111111-111-11--11-11121111--114------1-121-11112221111----------------111111111111--11--2------1-11-11-1-----------------11-------1-------------1--------------------------1---------------111------------------------1---1--------------------------------------------------2----------------11--1-1-------2-1-1--11-----1--------1---11----------------1------------------------------1--1----------------------------------1---------------------------------1----------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ----------------------------------------------------1----------------------------------------------------------------------------------------------1-1-1-----------------------

Master   AminoSeq   


1: . . . . + .: 60 :MNPFFIITTRDHMMTTTFDHAPETKAGIAGDDAQQVYDALMRTFEDYKAENDSRLQAIEK:Sequence : :Sec Str : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|18->74|PF03396|2e-04|33.3|57/291|Pox_RNA_pol_35 61: . . . * . .: 120 :RGGDVIAEDKVARIDAALNAQQRRLDELALKQARPQLGADSALRPRGAAEHKSAFDAYIR:Sequence : :Sec Str :$$$$$$$$$$$$$$ :RP:PFM|18->74|PF03396|2e-04|33.3|57/291|Pox_RNA_pol_35 121: . . + . . .: 180 :NGDAATLRQIETKALSVGSNPDGGYLVPEELERSIAARLSAISPIRGLASVRQISGSVYK:Sequence : cHHHHccccccTTGGGc:Sec Str : ===========================================:RP:SCP|138->428|1ohgA|9e-33|15.9|270/280|d.183.1.1 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|144->426|PF05065|2e-32|39.6|265/271|Phage_capsid 181: . * . . . .: 240 :KPFMTAGPATGWVGEAAARPQTSSPTLDALSFPAMELYAMPAATATLLDDAAVNLDDWLT:Sequence :EEEEccccEEEEEEEEcccccccccEEEEEEEEcEEEEEEEEEcTTTTccHHTHHHHHTT:Sec Str : XXXXXXXXXXX :SEG|222->232|aatatllddaa :============================================================:RP:SCP|138->428|1ohgA|9e-33|15.9|270/280|d.183.1.1 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|144->426|PF05065|2e-32|39.6|265/271|Phage_capsid 241: + . . . . *: 300 :GEIDTVFAEQEGAAFVSGDGINKPKGFLAAPTVANAAWSWGNLGFVATGAAGAFPASNPS:Sequence :TTHHHHHHHHHHHHHHcccccTTccccHHHHcEEccGcccHHHHcEEccGGGccTTccHH:Sec Str :============================================================:RP:SCP|138->428|1ohgA|9e-33|15.9|270/280|d.183.1.1 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|144->426|PF05065|2e-32|39.6|265/271|Phage_capsid 301: . . . . + .: 360 :DVLIDLMFALKPGYRQNASFVMNRRTQAAIRKFKDNNGVYLWQPPATASGRASLIGFPLA:Sequence :HHHHHHHHHHHTTTccccEEEccTTTTHHHHTcEETTTEEcccccTccccccccTTcccc:Sec Str :============================================================:RP:SCP|138->428|1ohgA|9e-33|15.9|270/280|d.183.1.1 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|144->426|PF05065|2e-32|39.6|265/271|Phage_capsid 361: . . . * . .: 420 :DAEDMPDIAANSLAIAFGDFRRGYLIVDRQGVRVLRDPYSAKPYVLFYTTKRVGGGVQDF:Sequence :ccTTccT cTEEEEEcHHHHcEEEEEEEEEEEEEcccTTTTEEEEEEEEEEEccccG:Sec Str :============================================================:RP:SCP|138->428|1ohgA|9e-33|15.9|270/280|d.183.1.1 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|144->426|PF05065|2e-32|39.6|265/271|Phage_capsid 421: . . + . . .: 480 :DAIKLLKFGGS :Sequence :GGEEEEEc :Sec Str :======== :RP:SCP|138->428|1ohgA|9e-33|15.9|270/280|d.183.1.1 :$$$$$$ :RP:PFM|144->426|PF05065|2e-32|39.6|265/271|Phage_capsid