[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABE39205.1 rpal2 ABE39205.1 "phage major capsid protein, HK97"
MNPFFIITTRDHMMTTTFDHAPETKAGIAGDDAQQVYDALMRTFEDYKAENDSRLQAIEK
RGGDVIAEDKVARIDAALNAQQRRLDELALKQARPQLGADSALRPRGAAEHKSAFDAYIR
NGDAATLRQIETKALSVGSNPDGGYLVPEELERSIAARLSAISPIRGLASVRQISGSVYK
KPFMTAGPATGWVGEAAARPQTSSPTLDALSFPAMELYAMPAATATLLDDAAVNLDDWLT
GEIDTVFAEQEGAAFVSGDGINKPKGFLAAPTVANAAWSWGNLGFVATGAAGAFPASNPS
DVLIDLMFALKPGYRQNASFVMNRRTQAAIRKFKDNNGVYLWQPPATASGRASLIGFPLA
DAEDMPDIAANSLAIAFGDFRRGYLIVDRQGVRVLRDPYSAKPYVLFYTTKRVGGGVQDF
DAIKLLKFGGS
//