[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rpal2:ABE39246.1"

            "Peptidase S1C, Do"
            ""

OrgPattern --1----1111111111111111-111112-1--1-----------1-----------------1-13 2482611211111134433-33444333333434543353344433113221344211113521325344211111111111512222112112111--1111123212211111111111111121111111131333654444363473342233333433233554753322223322236633322-423222222222222222223333223122432211111136222222222222222222221111111111111111111122211111111111111111111111111111111111111111111111211311111111111423322223231142221222222223322221-222A3337333337499A8436466333333333333-67666654473173336767553443333312333322333333333233349331111111111111111111211111111122122122222444544334445545444444554444322543553423443422332422221111111223363231121232432221232342242555586351111111111111111111121121332222234222222222222222222222221-2323411-11133332333333333333-3333333333333333333333332223333333333333333333332333133333333333311321111222225342212222222221222223222222223322222222222222322---------12222222222222222222222222222--4133333311121222331-------------111---------1111111111463 1---111-1---111---------------------------------------------------------------------------------------------A-25544c24313454752749J4-439132255433142224216454431-111--11121--214454r44476977A-793421117 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MTDRNTDLPSQPSRQPDRRSLLSARKFALMASVVAGLGAGAFGLSQTSTPVDLFSTPAHA:Sequence : :Sec Str : XXXXXXXXXXXXXXX :SEG|31->45|asvvaglgagafgls 61: . . . * . .: 120 :QVGNKVNQAQQPVGFADIVEKVKPSVISVKVNIAEKTAKNEDRAEDSPFQPGSPMERFFR:Sequence : cccccHHHHHHHGGGEEEE EEEEEEEEccccccccTTcccccEEEEEE:Sec Str : ==================================================:BL:SWS|71->523|DEGP_BRUME|e-121|53.8|446/513 121: . . + . . .: 180 :RFGGEMPPGMRGHRGGGTMTGQGSGFFISADGYAVTNNHVVDGADKVEVTTDDGKTYKAK:Sequence :EEEEEE cccHHHHHHHHHHHHHTTcHHHHHHHHHTTcTTTT:Sec Str : XXXXXXXXXXXXXXXXXXXXXXX :SEG|123->145|ggemppgmrghrgggtmtgqgsg : ===================================:RP:SCP|146->307|2bhgA1|1e-33|19.7|152/194|b.47.1.4 :============================================================:BL:SWS|71->523|DEGP_BRUME|e-121|53.8|446/513 181: . * . . . .: 240 :VIGTDQRTDLALIKAEGRTDFPFAKLSEGKPRIGDWVLAVGNPFGLGGTVTAGIVSASGR:Sequence :cccHHHHHHHHHHHHHHHHHHHHcTccccccccEEEEEEEEccccEcEEEEEEEccEEEc:Sec Str :============================================================:RP:SCP|146->307|2bhgA1|1e-33|19.7|152/194|b.47.1.4 :============================================================:BL:SWS|71->523|DEGP_BRUME|e-121|53.8|446/513 241: + . . . . *: 300 :DIGNGPYDDFIQIDAPVNKGNSGGPAFDTNGEVMGVNTAIYSPSGGSVGIAFSIPASTVK:Sequence :cccEcGEEEEEEEEEEEcccccccHHHHHHHHHHHHHHHccccTGGGcEEEEEEEEcccc:Sec Str :============================================================:RP:SCP|146->307|2bhgA1|1e-33|19.7|152/194|b.47.1.4 : =====================:RP:SCP|280->397|1nf3C|1e-23|17.8|118/123|b.36.1.1 :============================================================:BL:SWS|71->523|DEGP_BRUME|e-121|53.8|446/513 301: . . . . + .: 360 :TVVQQLKDKGSVSRGWIGVQIQPVTPEIADSLGLKKPDGALVAEPQPNGPAAKAGIESGD:Sequence :HTTccEEEEcTTccEEEEccEHHHHHHHHHHHHTTcccccEEccEEETTEEEEEEEcTTc:Sec Str :======= :RP:SCP|146->307|2bhgA1|1e-33|19.7|152/194|b.47.1.4 :============================================================:RP:SCP|280->397|1nf3C|1e-23|17.8|118/123|b.36.1.1 :============================================================:BL:SWS|71->523|DEGP_BRUME|e-121|53.8|446/513 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|314->394|PF00595|3e-08|47.3|74/82|PDZ 361: . . . * . .: 420 :VITAVNGTPVKDARELARTIGGFAPGNTVKLTVVHKGADRELNLTLGQLPNQVEAKVNDG:Sequence :cEEEEcccccccGGGTTcccccccTTccccEEEEETTEEEEEEEEEcccEcccEEEEccc:Sec Str : XXX:SEG|418->428|ndggdngnsss :===================================== :RP:SCP|280->397|1nf3C|1e-23|17.8|118/123|b.36.1.1 :============================================================:BL:SWS|71->523|DEGP_BRUME|e-121|53.8|446/513 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|314->394|PF00595|3e-08|47.3|74/82|PDZ 421: . . + . . .: 480 :GDNGNSSSRGTEVPRLGLTVAPASSVAGAGKDGVVVTDVDPKSAAADRGFKEGDVILEVA:Sequence :TTcccccGGGccHHHHHccccHHHHTcTTcTTccEEEEEEEEETTGGGTccTTcEEcccc:Sec Str :XXXXXXXX :SEG|418->428|ndggdngnsss : =================================:RP:SCP|448->499|1sotA1|4e-09|28.8|52/78|b.36.1.4 :============================================================:BL:SWS|71->523|DEGP_BRUME|e-121|53.8|446/513 481: . * . . . .: 540 :GKNVASPGDVREAINTAKADNKNSVLIRVRSGGSSRFVAVPISAKG :Sequence :ccccccHHHHHHHHHTcTcTGccccEEEEEETTEEEEccccccccc :Sec Str :=================== :RP:SCP|448->499|1sotA1|4e-09|28.8|52/78|b.36.1.4 :=========================================== :BL:SWS|71->523|DEGP_BRUME|e-121|53.8|446/513