[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rpal2:ABE39379.1"

            "Heavy metal efflux pump CzcA"
            ""

OrgPattern -------------------------------------------------------------------- D9K-------------------------------------------11-1--111-11--11--1--1111------------44366FGHD-I24---23G4B8LBJ8C--------------342344533465111111--1-57555451122222534362D48A4-2-----2-----2111--11212222222222222221111112212112122------6311111111111111111111-----------------------------------------------------------------------6116-------1-1-122---------1-13122522213-1-----31E3BG77C11111BEOJSI9HLHIGD45574664547-NQGGPKML5A9-FAACAADAA98ABL6A96285655434888888888CB866961111111111--1-221121111111-111338936755BDHIGIBA7776CCFGAAAA7ADBFCGGN-5GHF7BA9BMFA7A6AGG9FAC89111111187B6BF74A2466648A5531694779B77AB9AE92A62111222222333333333553488B875JE9ICDB6DEFFEFEKLFFHHDJQKMG--1C84A------76677B67999788A77-6887789768797777777CDC773456545666666546455A64664761-877777765777--17343335989H9C651111121111111117779759222A8DEEECCEFCDFEB99BB111111111B5AAA666669CDCBGHDAEAA8AA54441-97BC56BB11111111-----------------------------1---111118C6 -------------1---------------------------------------------------------------------------------1--------------------------------------------------------------4----4-2-------5--------------K-----7---- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MIEKLLAFSVRQRWLVMIGVLMMAAFGAWNFTRLPIDAVPDITNVQVQINTNAPGYSPLE:Sequence : cHHHHHHcTTTTTHHHHHHHHHHHHHHHHccccccccccccEEEEccccccccHHH:Sec Str :============================================================:BL:SWS|1->1049|HELA_LEGPN|0.0|61.0|1032/1052 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|8->1048|PF00873|e-155|36.3|998/1014|ACR_tran 61: . . . * . .: 120 :VEQRITFPIETAMGGLPNLVNTRSLSRYGLSQVTVVFKDGTDIYFARQLVNERVQRVKDI:Sequence :HHTTTHHHHcTTcccccccccccEEEETccEEccEEccTTccHHHHHHHHHHHHHHHGGG:Sec Str : =========================================================:RP:SCP|64->225|1mwkA2|5e-35|15.9|145/163|c.55.1.1 :============================================================:BL:SWS|1->1049|HELA_LEGPN|0.0|61.0|1032/1052 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|8->1048|PF00873|e-155|36.3|998/1014|ACR_tran 121: . . + . . .: 180 :LPVGIETAMGPVSTGLGEIYMYTVEAKEGAKNAEGKPYTPSDLRTAQDWIIKPQLRNVAG:Sequence :ccHHHHHHcccEEEccccccEEEEEEEccccHEccccccHHHHHHHHHHTTHHHHHcccc:Sec Str :============================================================:RP:SCP|64->225|1mwkA2|5e-35|15.9|145/163|c.55.1.1 :============================================================:BL:SWS|1->1049|HELA_LEGPN|0.0|61.0|1032/1052 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|8->1048|PF00873|e-155|36.3|998/1014|ACR_tran 181: . * . . . .: 240 :VNEVNTIGGFEKQFHVLPDPARLMAYRLSFRDVMTSLASNNANVGAGYIEKNGEQYLVRT:Sequence :ccEEEEEcccccccEEEEcHHHHHTTTccHHHHHHHHTTTcccccccccccccccccccc:Sec Str :============================================= :RP:SCP|64->225|1mwkA2|5e-35|15.9|145/163|c.55.1.1 : ======:RP:SCP|235->333|1iwgA2|8e-22|21.2|99/104|d.58.44.1 :============================================================:BL:SWS|1->1049|HELA_LEGPN|0.0|61.0|1032/1052 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|8->1048|PF00873|e-155|36.3|998/1014|ACR_tran 241: + . . . . *: 300 :PGQVANVEDIRQIVIGSRNGVPVRIMDVAEVKEGTDLRTGAATVSGKEVVLGTAMLLIGE:Sequence :ccccccHHHHHccEEccTTTccEEHHHHEEEEccccccccEEEETTEEcccEEEEccccc:Sec Str :============================================================:RP:SCP|235->333|1iwgA2|8e-22|21.2|99/104|d.58.44.1 :============================================================:BL:SWS|1->1049|HELA_LEGPN|0.0|61.0|1032/1052 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|8->1048|PF00873|e-155|36.3|998/1014|ACR_tran 301: . . . . + .: 360 :NGRTVAQRVAAKLEQIQKSLPEGISLRAIYDRTHLIDATIATVEKNLIEGALLVIAILFL:Sequence :cHHHHHHHHHHHHTTTcccccccEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHT:Sec Str : XXXXXXXXXX:SEG|351->362|allviailflil :================================= :RP:SCP|235->333|1iwgA2|8e-22|21.2|99/104|d.58.44.1 : ===================================:RP:SCP|326->506|1iwgA7|1e-14|13.8|174/199|f.35.1.1 :============================================================:BL:SWS|1->1049|HELA_LEGPN|0.0|61.0|1032/1052 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|8->1048|PF00873|e-155|36.3|998/1014|ACR_tran 361: . . . * . .: 420 :ILGNIKAAFATALVIPLSMLFTITGMFENKVSANLMSLGAIDFGIIIDGAVIIVENCLRL:Sequence :TccccTTTTHHHHHHHHHHHHHHHHHGGGTccccHHHHHHHHHHHHHHHHHHHHHHHHHH:Sec Str :XX :SEG|351->362|allviailflil : XXXXXXXXXXXXXXX :SEG|400->414|aidfgiiidgaviiv :============================================================:RP:SCP|326->506|1iwgA7|1e-14|13.8|174/199|f.35.1.1 :============================================================:BL:SWS|1->1049|HELA_LEGPN|0.0|61.0|1032/1052 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|8->1048|PF00873|e-155|36.3|998/1014|ACR_tran 421: . . + . . .: 480 :LAHEQQRRGRLLTREERFETIIAGAREVIKPSLFGTLIIAVVYLPVLTLTGVEGKMFTPM:Sequence :HHTTccccccccHcccHHHHHHHHTTTcHHHHTTHHHHHHTTTTTccccccTTTHHHHHH:Sec Str :============================================================:RP:SCP|326->506|1iwgA7|1e-14|13.8|174/199|f.35.1.1 :============================================================:BL:SWS|1->1049|HELA_LEGPN|0.0|61.0|1032/1052 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|8->1048|PF00873|e-155|36.3|998/1014|ACR_tran 481: . * . . . .: 540 :ALTVLMALLGASLLSMTFVPAAVALMVTGKVSEKENWFMRLAHRTYVPLLDLAVRLRVVV:Sequence :HHHHHHHHHHHHHHTTTTHHHHcTTTccccHHTTTTTTTTTHHHHHHHHHccccTTcTTT:Sec Str : XXXXXXXXXXXXXXXX :SEG|482->497|ltvlmallgasllsmt : XXXXXXXXXXXXXX:SEG|527->550|vplldlavrlrvvvaaaavvlviv :========================== :RP:SCP|326->506|1iwgA7|1e-14|13.8|174/199|f.35.1.1 :============================================================:BL:SWS|1->1049|HELA_LEGPN|0.0|61.0|1032/1052 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|8->1048|PF00873|e-155|36.3|998/1014|ACR_tran 541: + . . . . *: 600 :AAAAVVLVIVSGYAATRMGGEFIPSLDEGDVAIQAMRIPGTSLTQSLEMQMALEKRLLAI:Sequence :HHHHHHHHHHHHHHHHHccccccccccccEEEEEEEccTTccHHHHHHHHHHHHHTTccT:Sec Str :XXXXXXXXXX :SEG|527->550|vplldlavrlrvvvaaaavvlviv : ==================================:RP:SCP|567->668|1iwgA3|6e-15|13.1|99/107|d.58.44.1 :============================================================:BL:SWS|1->1049|HELA_LEGPN|0.0|61.0|1032/1052 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|8->1048|PF00873|e-155|36.3|998/1014|ACR_tran 601: . . . . + .: 660 :PEVKEAFARTGTAEVATDPMPPSISDGYVMLKPRDQWPDPKKPKLEVMKEIETASEEVAG:Sequence :TTEEEEEEEEEEccccEEE EEEEEEEEEEccTTTcccGGGcHHHHHHHHHHHTcccTT:Sec Str :============================================================:RP:SCP|567->668|1iwgA3|6e-15|13.1|99/107|d.58.44.1 :============================================================:BL:SWS|1->1049|HELA_LEGPN|0.0|61.0|1032/1052 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|8->1048|PF00873|e-155|36.3|998/1014|ACR_tran 661: . . . * . .: 720 :NLYELSQPIQLRFNELISGVRSDVGVKIFGDDLDVLAQVAAQVQAILQTIKGAADVKTEQ:Sequence :cccEEEcccTTccccccccEEEEEEccccccTTHHHHHHHHHHHHHHccGGGccccEEcc:Sec Str : XXXXXXXXXXXXXXXXXX :SEG|691->708|ddldvlaqvaaqvqailq :======== :RP:SCP|567->668|1iwgA3|6e-15|13.1|99/107|d.58.44.1 :============================================================:BL:SWS|1->1049|HELA_LEGPN|0.0|61.0|1032/1052 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|8->1048|PF00873|e-155|36.3|998/1014|ACR_tran 721: . . + . . .: 780 :VAGLPVLTVKLDRQALARFGINVADVQSLVEIAVGGKSAGLVFEGDRRFDLVVRLPDHLR:Sequence :cccEEcccccccHHHHHHTTccHHHHHHHHHHHHHcccccEEEccccEEEccccccGGGc:Sec Str : ========================================================:RP:SCP|725->831|1iwgA6|5e-15|14.8|88/88|d.225.1.1 :============================================================:BL:SWS|1->1049|HELA_LEGPN|0.0|61.0|1032/1052 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|8->1048|PF00873|e-155|36.3|998/1014|ACR_tran 781: . * . . . .: 840 :TDVEAIKRLPIPLPPADGQAKATPAVFGNSPLAQMRYAPLAELAEISVSPGPNQISREDG:Sequence :ccTTTGGGcEEEcTGTTccGcccGGGGTTcHHHHHHEEEGGGcccccccEEccEEEEETT:Sec Str :=================================================== :RP:SCP|725->831|1iwgA6|5e-15|14.8|88/88|d.225.1.1 :============================================================:BL:SWS|1->1049|HELA_LEGPN|0.0|61.0|1032/1052 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|8->1048|PF00873|e-155|36.3|998/1014|ACR_tran 841: + . . . . *: 900 :KRRIVVSANVRGRDLGSFVGEAQQLVAGKVKLPAGYWIGWGGQFEQLVSATERLTIVVPI:Sequence :EEEEEEEEccccccHHHHHHHHHHHHHHHHTccTTcEEEEcHHHHHHHcccccHHHHHHH:Sec Str : X:SEG|900->917|iallliflllfislgsaa : ===========================================================:RP:SCP|842->1054|1iwgA8|2e-22|22.5|213/222|f.35.1.1 :============================================================:BL:SWS|1->1049|HELA_LEGPN|0.0|61.0|1032/1052 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|8->1048|PF00873|e-155|36.3|998/1014|ACR_tran 901: . . . . + .: 960 :ALLLIFLLLFISLGSAADALLVFSGVPLALTGGIFALLLRGIPLSISAGIGFIALSGVAV:Sequence :HHHHHHHHHHHHTTcccTTHHHHTTHHHHHHHHcTTccccccccTTHHHHHHHHHHHHHH:Sec Str :XXXXXXXXXXXXXXXXX :SEG|900->917|iallliflllfislgsaa :============================================================:RP:SCP|842->1054|1iwgA8|2e-22|22.5|213/222|f.35.1.1 :============================================================:BL:SWS|1->1049|HELA_LEGPN|0.0|61.0|1032/1052 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|8->1048|PF00873|e-155|36.3|998/1014|ACR_tran 961: . . . * . .:1020 :LNGLVIITFIERLRGDGRKIVDAVREGALTRLRPVLMTALVASLGFVPMALATGAGAEVQ:Sequence :HHHHHHHHHHTTTTcccccTTTHHHHHHHTTHHHHHHHHHHHHHHHccTTTcccccccHH:Sec Str :============================================================:RP:SCP|842->1054|1iwgA8|2e-22|22.5|213/222|f.35.1.1 :============================================================:BL:SWS|1->1049|HELA_LEGPN|0.0|61.0|1032/1052 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|8->1048|PF00873|e-155|36.3|998/1014|ACR_tran 1021: . . + . . .:1080 :RPLATVVIGGIVSSTILTLLVLPALYILFRREASPAELAASSVPTKQGDH :Sequence :HHHHHHHHHHHHHHHHHHHHHHHHHTc :Sec Str :================================== :RP:SCP|842->1054|1iwgA8|2e-22|22.5|213/222|f.35.1.1 :============================= :BL:SWS|1->1049|HELA_LEGPN|0.0|61.0|1032/1052 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|8->1048|PF00873|e-155|36.3|998/1014|ACR_tran