[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rpal2:ABE39396.1"

            "ATP dependent DNA ligase"
            ""

OrgPattern -----------------------1-------------------------------1---11-----1- 113-2---------13311-11--1111111123243253-1---1---1--111-----112--111------------1------------------2-1-1-311-1--------------1---------------------------------------------------------------11---1--------------------------------------------------------------------------------------------------------------------------------------------------------1----1---111-111---111--------1--3-----1241231111211----------1---------181--5513434534611------1111------------11-----------------------------------112---1--1112111-----21131111---21222---11--111-1-1-1----1--1-----------111-1--------------111---1--1121-2---------------------------------------------------------------------------------------------------------------------------------------------------------------1-111------------------------------------11111-11111111111------------------------2112122----------------------------------------------------------------1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MAKRARVVRIHAEGAVPAPMPGFVQPQLATLRTRPPSGAGWIHEIKLDGYRGQAHVGPQG:Sequence : HHHHHHHTccccccccccEEEEEccGGGHHHHHTccEEEEEEccEEEEEEETEEE:Sec Str : ======================================:RP:SCP|23->206|1fviA2|1e-24|13.5|171/184|d.142.2.1 : ===================================:BL:SWS|26->309|Y963_MYCBO|1e-19|29.4|279/759 : $$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|38->206|PF01068|4e-15|32.1|168/201|DNA_ligase_A_M 61: . . . * . .: 120 :TRIYTRGGHDWSKMFAPLVAALSDAAVDEAVIDGEIVVVVDERTDFGALQADLAARRADR:Sequence :EEEEETTccEEEcccccccGGGGGccTTEEEEEEEEEEccccTTcEEEEEEEEEcTTTcc:Sec Str : XXXXXXXXXXXXXXXX :SEG|87->102|vdeavidgeivvvvde : XXXXXXXXXXXXX:SEG|108->120|alqadlaarradr :============================================================:RP:SCP|23->206|1fviA2|1e-24|13.5|171/184|d.142.2.1 :============================================================:BL:SWS|26->309|Y963_MYCBO|1e-19|29.4|279/759 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|38->206|PF01068|4e-15|32.1|168/201|DNA_ligase_A_M 121: . . + . . .: 180 :MLFYAFDLLHLDGYDLGPVPLTERKRLLKGLFDRGLEPPVVYSDSMDDGEAMFDGAGRLG:Sequence :EEEEEEEEEEETTEEcTTccHHHHHHHHHHHTcccEcccEETTcHHHHHHHHHHHHTTcc:Sec Str :============================================================:RP:SCP|23->206|1fviA2|1e-24|13.5|171/184|d.142.2.1 :============================================================:BL:SWS|26->309|Y963_MYCBO|1e-19|29.4|279/759 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|38->206|PF01068|4e-15|32.1|168/201|DNA_ligase_A_M 181: . * . . . .: 240 :WEGIVSKRADAPYRSGDRSLDWQKIKTSKREHLVIVGYVPATGGIAALHVARRDGDSLVY:Sequence :EEEEEEEEcccccccEcEEEEEEEEcTccEEEEEEEETTTEEEETTEEEEEEGGGTEEEE:Sec Str :========================== :RP:SCP|23->206|1fviA2|1e-24|13.5|171/184|d.142.2.1 : ===============================:RP:SCP|210->309|1a0iA1|2e-10|17.4|92/101|b.40.4.6 :============================================================:BL:SWS|26->309|Y963_MYCBO|1e-19|29.4|279/759 :$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|38->206|PF01068|4e-15|32.1|168/201|DNA_ligase_A_M 241: + . . . . *: 300 :AGKVGTGFSVKVGADLRRRLAEIETAAPPIAKPPPRHRPRWVRPVMSADVEYRDITASGH:Sequence :EEEccccccTTEEEEEEEcTTTTccccccccccTTTTcEEEccTTcEEEEEEcEEcTTcc:Sec Str : XXXXXXXXXXXXXXXXXXXX :SEG|266->285|aappiakppprhrprwvrpv :============================================================:RP:SCP|210->309|1a0iA1|2e-10|17.4|92/101|b.40.4.6 :============================================================:BL:SWS|26->309|Y963_MYCBO|1e-19|29.4|279/759 301: . . . . + .: 360 :LRHASFKGLAKAP :Sequence :EEccEEEEE :Sec Str :========= :RP:SCP|210->309|1a0iA1|2e-10|17.4|92/101|b.40.4.6 :========= :BL:SWS|26->309|Y963_MYCBO|1e-19|29.4|279/759