[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rpal2:ABE39402.1"

            "hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MIIFNLTSQAKTRIATAIRTIDGDEPLLSGAIGRRAKTDAPIILAGVIDVWPADSDGIHR:Sequence : ====================:BL:SWS|41->85|YPJI_ECOLI|3e-04|45.5|44/90 61: . . . * . .: 120 :VALSDAAGAVVWRAFAVTEITAGRGRLKAVDEYTALFGIRHPEPAYEYVCAQMKGRGIRP:Sequence : ===============================:RP:SCP|90->161|1d6uA3|6e-04|19.1|68/115|d.17.2.1 :========================= :BL:SWS|41->85|YPJI_ECOLI|3e-04|45.5|44/90 : =======:BL:SWS|114->184|MIAB_THEFY|2e-04|31.0|71/494 121: . . + . . .: 180 :CSDVDHDDWAEATRWVVADGGTRDPRRSWAKSAWRGRAVAHEAYAQAGLTLPMLGTWDPR:Sequence :========================================= :RP:SCP|90->161|1d6uA3|6e-04|19.1|68/115|d.17.2.1 :============================================================:BL:SWS|114->184|MIAB_THEFY|2e-04|31.0|71/494 181: . * . . . .: 240 :PSILFVTPSPEPVRPSMSLEDDAALADLA :Sequence : XXXXXXXXXX :SEG|199->208|leddaaladl :==== :BL:SWS|114->184|MIAB_THEFY|2e-04|31.0|71/494