[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rpal2:ABE39446.1"

            "aldo/keto reductase"
            ""

OrgPattern 22212212555545522944414-911B2993--------------------1-11111126433-11 58G2M21255425128722-23113B222222476749986E7LGE832DC1CGE228--7654G2JGCF32222354-1114--11-453--3------15142J-434--------------11-1111--12112232111A-42361132211---1--131663E3------------683-1331A3666666756456567644446855723536456777765I1555455555555554333637D36734534778888367178455221211113311111111111111-111111111211111111321-2222233131123-------2-21-311-1111---22--12-12-12-1A442-----A7A871-36644411111111117-67A68C698B1-KEE9DEENKFDD8615-52631344342222222268763114------------------------------243361665799898A9433488DA444535D8G4755--3346152252466114212-12-----------13211---2----2----3112-241-6888AI-21-2---------21-1--111--1112337232--311-222212-321221121-1--1-111------56682867889799988-767899679789B777779DEC671225376867667766678867776771-877777767777-----1-1--111-3275---6-3---------3332334-12C-77575887565675778111-11--11--12222221112255667664443------4111222111-1-----3----1------1------3------1221-53555165 ----535-7431242A798HFJCDIDC551433775574775745489DJBFPDCDA9654434612313228161323246665655-LbF77LC6864335C8811LEWHK896H443778BOM1J3PjB1A8F2221822KH42412H2573965D4234DE9587GFK9621754i1-49AEHQK6FL43A155H -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSWDTRRFGRGGPEIAPIGQGTWYIDRGDRTAAIAALRRGLDLGMTHIDTAEMYGDAEPL:Sequence :ccTTcEEEcTTccEEEcccEEcTTcTTcTTHHHHHHHHHHHHTTccEEEccGGGTHHHHH:Sec Str : ========================================================:RP:SCP|5->272|1pyfA|5e-53|29.4|265/311|c.1.7.1 : ==================================================:BL:SWS|11->281|YEAE_ECOLI|5e-60|45.0|271/284 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|29->268|PF00248|9e-35|43.9|239/281|Aldo_ket_red 61: . . . * . .: 120 :VAEAIDGRRDEVFLVSKVLPSNASRSGAIAACERSLKRLKTDRLDCYLLHWRGKVRLADT:Sequence :HHHHTTccGGGcEEEEEEcGGGccHHHHHHHHHHHHHHHTcccEEEEEEcccccccHHHH:Sec Str :============================================================:RP:SCP|5->272|1pyfA|5e-53|29.4|265/311|c.1.7.1 :============================================================:BL:SWS|11->281|YEAE_ECOLI|5e-60|45.0|271/284 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|29->268|PF00248|9e-35|43.9|239/281|Aldo_ket_red 121: . . + . . .: 180 :VAAFEELVAAGKIRSWGVSNFDAGDLWELLKVAGPGRIACNQVLYHLRERAIEHAVVPWC:Sequence :HHHHHHHHHHTcEEEEEEEcccHHHHHHHHHHcTcccccccEEEEEccTTcccHHHHHHH:Sec Str :============================================================:RP:SCP|5->272|1pyfA|5e-53|29.4|265/311|c.1.7.1 :============================================================:BL:SWS|11->281|YEAE_ECOLI|5e-60|45.0|271/284 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|29->268|PF00248|9e-35|43.9|239/281|Aldo_ket_red 181: . * . . . .: 240 :EAHGVAVTAYSPFGHDEFPEPRSAEGRLLQAIAGAHGATPRQVALAFLTRRPSLFAIPKA:Sequence :HHTTcEEEEEcTTGGcccTcGTTTTcHHHHHHHHHHTccHHHHHHHHHHHHTccEEcccc:Sec Str : X:SEG|240->253|aadaahaadnaaaa :============================================================:RP:SCP|5->272|1pyfA|5e-53|29.4|265/311|c.1.7.1 :============================================================:BL:SWS|11->281|YEAE_ECOLI|5e-60|45.0|271/284 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|29->268|PF00248|9e-35|43.9|239/281|Aldo_ket_red 241: + . . . . *: 300 :ADAAHAADNAAAASLRLSDEEIAAIDQAFPLGPEPASLPML :Sequence :ccHHHHHHHHccTTccccHHHHHHHHTTccccccTTccc :Sec Str :XXXXXXXXXXXXX :SEG|240->253|aadaahaadnaaaa :================================ :RP:SCP|5->272|1pyfA|5e-53|29.4|265/311|c.1.7.1 :========================================= :BL:SWS|11->281|YEAE_ECOLI|5e-60|45.0|271/284 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|29->268|PF00248|9e-35|43.9|239/281|Aldo_ket_red