[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rpal2:ABE39477.1"

            "Phenylacetic acid degradation-related protein"
            ""

OrgPattern -------------------------------------------------------------------- ----1----------------------------------1-----------------1--------1-------------------1------------------------------------------------------------------------------------------------1-1---------------------------------11-----------------------------------------------------------------------------------------------------------------------------------------------------------2112-------3-2-----11-1111111111-------1-1--2-------1--------2-1----------------------------------------------------------------1-------------------------21---11---------1---------1-------------------------------------------1-----------------------------------------1111--------------------------------------------------------------------------------------------------------------------------------------------------1--1---1-1111-------------------------------------1------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MDRESVFWKIADGRLPPPPCAETLGIEFLRVTPESGSIEVKFEATSAFLNLAGNVQGGFL:Sequence : HHHHHHHHTTTcHHHHTTcEEEEEccccTEccEEEEEccTTTcTTccccHHHH:Sec Str : ==========================================:RP:SCP|19->133|1zkiA1|1e-19|25.7|113/126|d.38.1.5 : ===================================:BL:SWS|26->141|Y293_THEAC|3e-04|29.6|108/132 : $$$$$$$$$:RP:PFM|52->128|PF03061|3e-04|37.7|77/79|4HBT 61: . . . * . .: 120 :AAMLDDTMGPALVATLGAGEFAPTVSLNVQFHRPARVGALKGIGRVLLRGKEVCQLSGEL:Sequence :HHHHHHHHHHHHHTTccTTEEEEEEEEEEEEcccccccEEEEEEEEEEEcccEEEEEEEE:Sec Str :============================================================:RP:SCP|19->133|1zkiA1|1e-19|25.7|113/126|d.38.1.5 :============================================================:BL:SWS|26->141|Y293_THEAC|3e-04|29.6|108/132 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|52->128|PF03061|3e-04|37.7|77/79|4HBT 121: . . + . . .: 180 :LQDDRVVATGTATAVIRRMGTQTAWAAAQKPA :Sequence :ETTccEEEEEEEEEEEEEcTcccccccccccc :Sec Str :============= :RP:SCP|19->133|1zkiA1|1e-19|25.7|113/126|d.38.1.5 :===================== :BL:SWS|26->141|Y293_THEAC|3e-04|29.6|108/132 :$$$$$$$$ :RP:PFM|52->128|PF03061|3e-04|37.7|77/79|4HBT