[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABE39477.1 rpal2 ABE39477.1 "Phenylacetic acid degradation-related protein"
MDRESVFWKIADGRLPPPPCAETLGIEFLRVTPESGSIEVKFEATSAFLNLAGNVQGGFL
AAMLDDTMGPALVATLGAGEFAPTVSLNVQFHRPARVGALKGIGRVLLRGKEVCQLSGEL
LQDDRVVATGTATAVIRRMGTQTAWAAAQKPA
//