[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rpal2:ABE39517.1"

            "hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------1-------------------------------1--------------------------------------------------11-----------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MGTEITLDVAGVSVTYSKNHRGIDHGSIFQERDRRAVKSDQLDYDWYETEGEDPTASEMA:Sequence 61: . . . * . .: 120 :FTRPLSHVVPRLELLGFNLERVRREYDAVVQNWLEERQSLRDEEDEPTPDVMSFAEFTEF:Sequence 121: . . + . . .: 180 :VKAHPLDRLDDTFISGSDDASEAKIQGRFGGMQFERFPFYRPYDRQAYSERTFFGGLVDI:Sequence 181: . * . . . .: 240 :LHPYSVLRILAEANGYAPVVWQYGPLVEGGYAPEREFVPHARRTETFLIATEGSSDVHIL:Sequence 241: + . . . . *: 300 :KHALALLRPGIADFFRFIDVSESHPFSGTGNLVKFAEGLAKIDVQNQVVFVFDNDAEGLD:Sequence 301: . . . . + .: 360 :AHQKLSALTLPANMRRIMLPELDAFRAFPAEGPEGLHSSDINRRAAAIECYLDLEVGGYP:Sequence 361: . . . * . .: 420 :PAKVLWTNYKKGLGIYQGALEFKESYIKEFLKQTPESLSDGSYDVRKIEAVLDLLIAECT:Sequence 421: . . + . . .: 480 :AMAVDQWDPAEVELRDTY :Sequence