[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABE39517.1 rpal2 ABE39517.1 "hypothetical protein"
MGTEITLDVAGVSVTYSKNHRGIDHGSIFQERDRRAVKSDQLDYDWYETEGEDPTASEMA
FTRPLSHVVPRLELLGFNLERVRREYDAVVQNWLEERQSLRDEEDEPTPDVMSFAEFTEF
VKAHPLDRLDDTFISGSDDASEAKIQGRFGGMQFERFPFYRPYDRQAYSERTFFGGLVDI
LHPYSVLRILAEANGYAPVVWQYGPLVEGGYAPEREFVPHARRTETFLIATEGSSDVHIL
KHALALLRPGIADFFRFIDVSESHPFSGTGNLVKFAEGLAKIDVQNQVVFVFDNDAEGLD
AHQKLSALTLPANMRRIMLPELDAFRAFPAEGPEGLHSSDINRRAAAIECYLDLEVGGYP
PAKVLWTNYKKGLGIYQGALEFKESYIKEFLKQTPESLSDGSYDVRKIEAVLDLLIAECT
AMAVDQWDPAEVELRDTY
//