[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rpal2:ABE39592.1"

            "regulatory proteins, IclR"
            ""

OrgPattern ------------------------5-----22------------------------------------ --3-1-1211111-22122-24--1C2222215444-5GE-1-1342----1A59411--224183A57521111233----3----1-----1------------------------------------------111------1-------------------------------------1---1---31-------1-11----13222---1-12323--------21----------------------1-------------------------------------------------------------------12--------------------------1-----1-11-1224-1-2---------------2-2-1--73111-22222222212-11---2--43--4332125333334----237--12233111111112---------------------------------------1---9953111221-----4447------5-A88C4--11--111-5---741------------------111-1-------------1211123-1-----------1-------------------------------1-------------------------1--------2-142--1--1111111--111111111-1111111223212-1-1-1111111111111-311-111---211111111111----------------12111--1-----1--1--------112-11111312-1121-1111--------------------1--------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSTDEASPGPLARYIDVLEVIAAFSGAITLADVSSILDLPKTTAHRLLKGLVRAGLAVEG:Sequence : ccTHHHHTcHHHHHHHHHHTTccccHHHHHHHHTccHHHHHHHHHHHHHTTcEEEE:Sec Str : ==================================================:RP:SCP|11->75|1mkmA1|1e-08|17.2|64/75|a.4.5.33 : ==================================================:BL:SWS|11->233|YIAJ_ECOLI|6e-17|29.9|221/282 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|11->62|PF09339|9e-05|45.1|51/52|HTH_IclR 61: . . . * . .: 120 :DAGRSYYVGERLTRLLHAGADDGWYASLAGPHLRALTEASTETCYLARLIGSRVVVALSY:Sequence :EEEEETTEEEEEEEEcccEEEEcTTHHHHHHHHHHHHHHHccEEEEEEEETTEEEEEEEE:Sec Str :=============== :RP:SCP|11->75|1mkmA1|1e-08|17.2|64/75|a.4.5.33 : ==================================:RP:SCP|87->228|1td5A|5e-22|25.4|142/179|d.110.2.2 :============================================================:BL:SWS|11->233|YIAJ_ECOLI|6e-17|29.9|221/282 :$$ :RP:PFM|11->62|PF09339|9e-05|45.1|51/52|HTH_IclR 121: . . + . . .: 180 :SPDVRWRGYVQPGIEMPVNAAATGKAIMAFQSKVLIAEALSHELPKPTINSHTSRKWIEQ:Sequence :cccccccccccccccEEGGcHHHHHTTcHHHHHHHHHHHHHHHHHHHHGGGTcccccHHH:Sec Str :============================================================:RP:SCP|87->228|1td5A|5e-22|25.4|142/179|d.110.2.2 :============================================================:BL:SWS|11->233|YIAJ_ECOLI|6e-17|29.9|221/282 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|133->228|PF01614|2e-08|37.6|93/127|IclR 181: . * . . . .: 240 :EFAKVRTNGYATCIGEIDEGLAAIAVPVRLPNGAVLHSVGMTGPLERIMNKQLSTRLAAL:Sequence :HHHHHHHHcEEEEEccccTTEEEEEEEccccTTccEEEEEEEHHHHHHcHHHHH :Sec Str : XXXXXX:SEG|235->253|trlaalrataatlakalal :================================================ :RP:SCP|87->228|1td5A|5e-22|25.4|142/179|d.110.2.2 :===================================================== :BL:SWS|11->233|YIAJ_ECOLI|6e-17|29.9|221/282 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|133->228|PF01614|2e-08|37.6|93/127|IclR 241: + . . . . *: 300 :RATAATLAKALALGSTIKQRSSS :Sequence : :Sec Str :XXXXXXXXXXXXX :SEG|235->253|trlaalrataatlakalal : ########## :PROS|246->255|PS00599|AA_TRANSFER_CLASS_2|PDOC00518|