[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rpal2:ABE39597.1"

            "ABC transporter related"
            ""

OrgPattern TSJBOGEHTSTQRORNmHSSMRRYzMQhkYcVGCDAD8HDFBASZRVhIO*se9OXLSWMQJHDW179 SYtO*dgessuaYWZVWTS-SmAAc*TTTTTRtpprz***W*b*v*uiokbQ***UTiGHp**f*w****cZZZZwcYXP*gnC7A6BPOQG4HGJH--FHQKKLfMXRS76777766679999EROLQVNOQSXQmss**HGH*aukvzdemcgVWNMOJPLhich***XHSHJFGHSDLIFkadVUjf8Wgy************************fs***kqwvvrts**ZeefgfddffeeeeeYYTVWzdZX**XQaTfxwMM**cYQZfjfehmlqxtpwwyxnroqnjrsmpqcedcbcedhfecb*rscadsrupm*r*********h*kt***aihe*mirl*fpRJ**rhbfijQbeWhmOVZZMdUSSLJNKIMbX***YQv****************-pu*ng*o***P9**************JKL**********VUVVVVVV*bfLTjY*77656666655667BC5689696697584MCGGDD***************y********p********CO**z*ltlr******ZnpJXKPhXFFFFFFFQOQcomd**PcY*iXkwVVkJgWcQSXiRWWXaar*Z*LHHQEIIJJFE9C9AAA99AGNDFKONklsMvSYJTGqTWabWNUeXUUVUUcYYaa5-DJQOL3-1111*z**X**w***x*y*uv-*wuw*w*xyw**zstvtst*****ihdooklmnnnnnlkokll*pklssqtP3************35IJCFCCDMNONQK*l*TUUXVTFJMKIPJNbJLNMLETFLSpayy*xy***s***yh***FEDBDEDCEJfnkyllmmlv*vutNPOKMLKHKIECCC45OQRRILJK89878777*DU9796B-7A76FC5DED86G688556ZlqRSg*hlgEjO 1222ZXF-YK7ALXNIEG9CKPGNEPJFFAA9BJEF9E9CACBB9BEEHLIIUNEFG9BAABA8A5581574C87572876657BC46-JK5EB8A987877AINB5MTeqKTNcVVEFBAFRKom9uB**m4oSsIIGAcDFhRBLED8XE9*HWSPmFX*GgLYA*ae*aeaLFKJ9*BCAEKxaY*C*xEF*s**R ------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MLTCNDLVVAHGDILALQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQL:Sequence :============================================================:RP:SCP|1->234|1ji0A|2e-46|57.5|233/240|c.37.1.12 :============================================================:BL:SWS|1->234|LIVF_SALTY|2e-58|50.0|232/237 : $$$$$$$$$$$$$$$$$$$$:RP:PFM|41->163|PF00005|8e-11|40.4|114/123|ABC_tran 61: . . . * . .: 120 :EGVSISEWSTDRRVAKGISQAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDRTFE:Sequence :============================================================:RP:SCP|1->234|1ji0A|2e-46|57.5|233/240|c.37.1.12 :============================================================:BL:SWS|1->234|LIVF_SALTY|2e-58|50.0|232/237 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|41->163|PF00005|8e-11|40.4|114/123|ABC_tran 121: . . + . . .: 180 :LFPRLKERRKQLGWSLSGGEQQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYERVKL:Sequence : ############### :PROS|136->150|PS00211|ABC_TRANSPORTER_1|PDOC00185| :============================================================:RP:SCP|1->234|1ji0A|2e-46|57.5|233/240|c.37.1.12 :============================================================:BL:SWS|1->234|LIVF_SALTY|2e-58|50.0|232/237 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|41->163|PF00005|8e-11|40.4|114/123|ABC_tran 181: . * . . . .: 240 :ISESGLTILVVEQNTVLALSVADRAYVLETGRIVLEGPASELKHNARVREAYLGR :Sequence :====================================================== :RP:SCP|1->234|1ji0A|2e-46|57.5|233/240|c.37.1.12 :====================================================== :BL:SWS|1->234|LIVF_SALTY|2e-58|50.0|232/237