[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rpal2:ABE39673.1"

            "N-acetylmuramoyl-L-alanine amidase"
            ""

OrgPattern ---------------------------------------------------------1---------- 211--------------------------------------------------------------------------------11111111111111--111121-221111111111111111111111111111-----------21-33111111111--12-3223--1-1---1-1--11211--1-2133333212-213121323312122122--11122222111111-1111111111---1-----11---------11-11-----------------------------------------11---111--1--13332132121-1--1111-11--11122222121131------1111-111111111111111111111111111111111-11111111111-1111111111111111111111111111111111111111121------------------------------11111111111111111111111111111111111111111111111111111111111111111111111111111211-1111111111111111111222221111111111111111111111111112111111111111111111111111111111111-111111--11133223333333333333-33334333333333333333332222233332232222333333333333321222222222222111111111111111111111111111111111----------2122221222111111222---------11111111111111111222222221111--11111111111111111-----------------------------1--------21 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKRGRDSLSGRANHFVLFRAILACAAALLCAAPTAGVAGEAVATSAPAPTSFPIAAEVRL:Sequence : :Sec Str : XXXXXXXXXXXXX :SEG|20->32|ailacaaallcaa 61: . . . * . .: 120 :AGDDTQTRFVIDLDRTVPMRAFALADPYRVVIDLPQVNFRLPAASGGTGRGLIKAYRYGL:Sequence : :Sec Str : ======================================================:BL:SWS|67->431|AMIC_ECOLI|1e-45|34.3|356/417 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|67->136|PF11741|3e-09|44.3|70/103|AMIN 121: . . + . . .: 180 :VMPGGSRVVLELSGPAKITKADMLEAANGQPARMVIELGSVDRTAFVESLGVEKGPELRP:Sequence : :Sec Str :============================================================:BL:SWS|67->431|AMIC_ECOLI|1e-45|34.3|356/417 :$$$$$$$$$$$$$$$$ :RP:PFM|67->136|PF11741|3e-09|44.3|70/103|AMIN 181: . * . . . .: 240 :AIGAADATSSVPHRVESPKLDAAKDDLRPVIVLDPGHGGIDNGTQSQSGVSEKALVLEFA:Sequence : cEEEEEcccccccccEEETTEEHHHHHHHHH:Sec Str : ===============================:RP:SCP|210->433|1jwqA|4e-38|34.1|176/179|c.56.5.6 :============================================================:BL:SWS|67->431|AMIC_ECOLI|1e-45|34.3|356/417 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|211->426|PF01520|8e-24|42.8|173/175|Amidase_3 241: + . . . . *: 300 :LALRDQMEKGGKYRVVLTRTDDTFIPLNDRVKIARAHSAALFVSIHADALPRGEGDAQGA:Sequence :HHHHHHHHHHcccEEEEEccccccccHHHHHHHHHHHTccEEEEEcccccccTTccccEE:Sec Str :============================================================:RP:SCP|210->433|1jwqA|4e-38|34.1|176/179|c.56.5.6 :============================================================:BL:SWS|67->431|AMIC_ECOLI|1e-45|34.3|356/417 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|211->426|PF01520|8e-24|42.8|173/175|Amidase_3 301: . . . . + .: 360 :TIYTLSDKASDAEAQRLADAENKADAIGGVNLTEEPTEVADILIDLAQRETKTFSNRFAQ:Sequence :EEcGGGHHHHHHHHHHHHHHHcccc :Sec Str :============================================================:RP:SCP|210->433|1jwqA|4e-38|34.1|176/179|c.56.5.6 :============================================================:BL:SWS|67->431|AMIC_ECOLI|1e-45|34.3|356/417 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|211->426|PF01520|8e-24|42.8|173/175|Amidase_3 361: . . . * . .: 420 :TLMREMKSATRLHKQPLKSAGFRVLKAPDVPSVLLELGYVSNKGDLKQLVSEQWRTKTVG:Sequence : cTcTTEEEGGGcccTTHHHHHTTcEEEEcccTTcHHHHHHHHHHHHH :Sec Str :============================================================:RP:SCP|210->433|1jwqA|4e-38|34.1|176/179|c.56.5.6 :============================================================:BL:SWS|67->431|AMIC_ECOLI|1e-45|34.3|356/417 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|211->426|PF01520|8e-24|42.8|173/175|Amidase_3 421: . . + . . .: 480 :AVALAIDSFFAKRLVSAGKPD :Sequence : :Sec Str :============= :RP:SCP|210->433|1jwqA|4e-38|34.1|176/179|c.56.5.6 :=========== :BL:SWS|67->431|AMIC_ECOLI|1e-45|34.3|356/417 :$$$$$$ :RP:PFM|211->426|PF01520|8e-24|42.8|173/175|Amidase_3