[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABE39699.1 rpal2 ABE39699.1 "conserved hypothetical protein"
MHGRTLRLLFAASIAGCLLVSSVDPGFAANVIITEEEGKLPPPREMPAPSDRGITRGPKI
ELDADDKVVLRAPLHLKLKFKTYGGSAIDLGALQATYIKEPAVDLTTRLKPFAQQTGIDI
PDAQLPPGEHFIQIVIKDSDGRAVTKVFKLKVAP
//