[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rpal2:ABE39735.1"

            "Lysine--tRNA ligase"
            ""

OrgPattern ------1111111111-1111----------------------11-11--111--------------- 111-1-2111121111111-1111-111111-11111111--1---11----111111----122121--1-------1111-21222111111111-1111111111-11111111111111111111111111111111222111111111111111111111111111111111111111-1111---11111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111211111111111111111121-1111111111111111111111111121111-----1111111111111------------11111111-1-22222222222221111---11111---1111111111121111-----------------------------------11111111111111111111111111111111111111111111111111111111111111111111111222221111111111222222222222222221111111111111111111111111111112222222211111111111111111112-2122212122222222223333334333-333333333333333333333322222222222222222222222222223212222222222221122222222222222222222222222223222222222222111111111111111111122222222222222222222222222222222222222222-222222--------11111111-111-111111-1-121111111111111111- --11112-422-11111111111111111111111111111-111111--1111111111111--111--21---211221-----21-12111111111---21---21---------------------------------------------------2-11-121------211162221-11321142221111 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MQGGTFASPWWDPARYLDRKPFLRARSAVTRAARDWFAAAEFAEVETAILQLSPGNETHL:Sequence : HHcHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHTTcEEcccccEEccccccccc:Sec Str : XXXXXXXXXXXXXX :SEG|31->44|raardwfaaaefae : ==============================================:RP:SCP|15->345|1bbuA2|3e-45|28.3|321/342|d.104.1.1 : ================:BL:SWS|45->345|SYK3_PROMH|5e-43|40.6|281/325 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|15->133,253->345|PF00152|8e-07|35.1|203/337|tRNA-synt_2 61: . . . * . .: 120 :HAPRTEFKGPDGELRTRFLRTSPEFACKKLLAAGEERIFEFARVFRDRERGRLHLPEFTM:Sequence :ccEEEETTTTETTTEEEEEccccHHHHHHHHHTTccEEEEEEEEEccccccTTcccEEEE:Sec Str :============================================================:RP:SCP|15->345|1bbuA2|3e-45|28.3|321/342|d.104.1.1 :============================================================:BL:SWS|45->345|SYK3_PROMH|5e-43|40.6|281/325 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|15->133,253->345|PF00152|8e-07|35.1|203/337|tRNA-synt_2 121: . . + . . .: 180 :LEWYRAGEGYQTVIADCAALIALAARTTGIGQFSFRGRTADPQAEPEMLTVAAAFARFAG:Sequence :EEEEEETccHHHHHHHHHHHHHHHHHHHHccEEEEcTTcTTcccEEEEccHHcccEEEEH:Sec Str : XXXXXXXXXXXX :SEG|134->145|iadcaalialaa :============================================================:RP:SCP|15->345|1bbuA2|3e-45|28.3|321/342|d.104.1.1 :============================================================:BL:SWS|45->345|SYK3_PROMH|5e-43|40.6|281/325 :$$$$$$$$$$$$$ :RP:PFM|15->133,253->345|PF00152|8e-07|35.1|203/337|tRNA-synt_2 181: . * . . . .: 240 :IDLLATIIGGEGDRDALARAAAAKVRVADDDNWSDIFSKVLVDHIEPRLGEGRLTVLCEY:Sequence :HHHHHHHHTGTTcHHHHHHHHHHHHHHTccccccccHHHHHHHHHHHHTGGcccEEEEcc:Sec Str : XXXXXXXXXXXXXXXXXXX :SEG|193->211|drdalaraaaakvrvaddd :============================================================:RP:SCP|15->345|1bbuA2|3e-45|28.3|321/342|d.104.1.1 :============================================================:BL:SWS|45->345|SYK3_PROMH|5e-43|40.6|281/325 241: + . . . . *: 300 :PAPEAALARTKADDPRVAERFEVYACGVELANGFGELTDAAEQRLRFTASMDEKERRYGE:Sequence :cGGGcTTcccccccTTcccEEEEEETTEEEEEEEEccccHHHHHHHHHHHHHHHHTTcTT:Sec Str :============================================================:RP:SCP|15->345|1bbuA2|3e-45|28.3|321/342|d.104.1.1 :============================================================:BL:SWS|45->345|SYK3_PROMH|5e-43|40.6|281/325 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|15->133,253->345|PF00152|8e-07|35.1|203/337|tRNA-synt_2 301: . . . . + .: 360 :RYPLDEDFLAAVGRMPEASGVALGFDRLVMLAAGAMRIDQVVWTPPADEAS :Sequence :cccccHHHHHHHTTcccEEEEEEEHHHHHHHHTTcccGGGccccccccccc :Sec Str :============================================= :RP:SCP|15->345|1bbuA2|3e-45|28.3|321/342|d.104.1.1 :============================================= :BL:SWS|45->345|SYK3_PROMH|5e-43|40.6|281/325 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|15->133,253->345|PF00152|8e-07|35.1|203/337|tRNA-synt_2