[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rpal2:ABE39842.1"

            "conserved hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111111------------------------------------11----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MRRVFLEFQNALLRGLAATGLALLIGIGGAIAQSGDLRAQDQNNKPPATANQPAQPPADP:Sequence : XXXXXXXXXXXXXXXXXXXXXX :SEG|11->32|allrglaatglalligiggaia : XXXXXXXXXXXXXXXXXXX:SEG|42->60|qnnkppatanqpaqppadp 61: . . . * . .: 120 :LKESQRKTDEFVEAAQAINGPAGNPECVWLGRRVVVLMWRDDLDTAFRHLDLYDRFGCPT:Sequence 121: . . + . . .: 180 :GHIQAAFRCLVRSGPIDPKVPEGLSGRVHACWINPTAQQQPAAATAAPAAPSGKPAANTQ:Sequence : XXXXXXXXXXXXXXXXX :SEG|155->171|ptaqqqpaaataapaap 181: . * . . . .: 240 :PAAPASGPATPAPATAPSSAPAK :Sequence :XXXXXXXXXXXXXXXXXXXXXX :SEG|181->202|paapasgpatpapatapssapa