[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABE39842.1 rpal2 ABE39842.1 "conserved hypothetical protein"
MRRVFLEFQNALLRGLAATGLALLIGIGGAIAQSGDLRAQDQNNKPPATANQPAQPPADP
LKESQRKTDEFVEAAQAINGPAGNPECVWLGRRVVVLMWRDDLDTAFRHLDLYDRFGCPT
GHIQAAFRCLVRSGPIDPKVPEGLSGRVHACWINPTAQQQPAAATAAPAAPSGKPAANTQ
PAAPASGPATPAPATAPSSAPAK
//