[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rpal2:ABE39945.1"

            "DNA polymerase III, delta prime subunit"
            ""

OrgPattern -------------------------------------------------------------------- 1111222222212222222-22222222222222222222111222222221222222--222122222212111222121221-112--1--1----1----1---11--111111111----21--------1-1212-221-1-211-1-11--1111112-1111--121111121211112111-11112222222212222222-11112211-13211------2-12212122122222222221111----211-11--------1------------------------------------------------111-------11-1-2-11----2-1--2122111111-22112211--1--1222211111122222222222222222222222-1121121221212222222222222222212122222212222222221122222--1--------------------------11222211111111111-----111-------11-11112111122-111-1---1122112212222222112122222221111111111222222222121111-211111-----1-----------1--1122-11111-11211111-21111112211-1---221-1-111--111-----------------------------------1----------------------------1--11111111111--1211111111112122---111-----1---------11112222222122222221222--111-11-111112222211-2222222222221111112-11111111111111-------1---1-1--111-1----11111--111111111 ---------------------------------------------------------------------------------------------------------------------------------------------------------------------1----1-----------------------1---- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSARKAAADIVAKLPRETTALFGHHVAEQALLDAYRGGRIAHAWLIGGAQGIGKATLAYR:Sequence : cHHHHTccccGGcGGGHHHHHHHHHHHHTTccccEEEEEccTTccHHHHHHH:Sec Str : ==============================================:RP:SCP|15->197|1jr3A2|1e-25|28.0|164/240|c.37.1.20 : ================================:BL:SWS|29->190|HOLB_PSEAE|1e-18|39.9|148/328 61: . . . * . .: 120 :MARFVLAHRDPLADAVQGAASLDLDPSHPVVRHVAAEAHGGLLTLERSVNDKGVLRNVIT:Sequence :HHHHHTcccccTTcccccEEEEcccccHHHHHHHHHHHHHHHTcccEEEEccGGGcTHTc:Sec Str :============================================================:RP:SCP|15->197|1jr3A2|1e-25|28.0|164/240|c.37.1.20 :============================================================:BL:SWS|29->190|HOLB_PSEAE|1e-18|39.9|148/328 121: . . + . . .: 180 :VDESRETIGFFGSTAAVEGWRVCIVDTVDDLNASSANALLKVIEEPPQRSLFLLISNSPA:Sequence :HHHHHHHHTTccEEEEEEETTEEEEEETTTEEEcTTTcEEEEEcTTccEEEEEccccEEE:Sec Str :============================================================:RP:SCP|15->197|1jr3A2|1e-25|28.0|164/240|c.37.1.20 :============================================================:BL:SWS|29->190|HOLB_PSEAE|1e-18|39.9|148/328 181: . * . . . .: 240 :RVLPTIQSRCRKLMLRPLATADVIAAAVAATDLAPGDPKLADAAAASEGSVSRALTLLGG:Sequence :EEcTTcccEEEEEEGGG :Sec Str : XXXXXXXXXXXXXXXXX :SEG|198->214|latadviaaavaatdla : XXXXXXX:SEG|234->245|altllggdaltl :================= :RP:SCP|15->197|1jr3A2|1e-25|28.0|164/240|c.37.1.20 :========== :BL:SWS|29->190|HOLB_PSEAE|1e-18|39.9|148/328 241: + . . . . *: 300 :DALTLHQKTTALLDSLPNVDPRALHALGESIGGTDRATLAAFVDGVDRWIAQRLRAGDAN:Sequence : :Sec Str :XXXXX :SEG|234->245|altllggdaltl : XX:SEG|299->310|ananlprlarla 301: . . . . + .: 360 :ANLPRLARLAEVWEKIGRAARDTEAYNLERKPLVFSVFGLLAEAVR :Sequence : :Sec Str :XXXXXXXXXX :SEG|299->310|ananlprlarla