[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABE39945.1 rpal2 ABE39945.1 "DNA polymerase III, delta prime subunit"
MSARKAAADIVAKLPRETTALFGHHVAEQALLDAYRGGRIAHAWLIGGAQGIGKATLAYR
MARFVLAHRDPLADAVQGAASLDLDPSHPVVRHVAAEAHGGLLTLERSVNDKGVLRNVIT
VDESRETIGFFGSTAAVEGWRVCIVDTVDDLNASSANALLKVIEEPPQRSLFLLISNSPA
RVLPTIQSRCRKLMLRPLATADVIAAAVAATDLAPGDPKLADAAAASEGSVSRALTLLGG
DALTLHQKTTALLDSLPNVDPRALHALGESIGGTDRATLAAFVDGVDRWIAQRLRAGDAN
ANLPRLARLAEVWEKIGRAARDTEAYNLERKPLVFSVFGLLAEAVR
//