[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rpal2:ABE39967.1"

            "Histone-like nucleoid-structuring protein H-NS"
            ""

OrgPattern -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-2-2--1---------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111----------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MNRNRSADLIPSRWEGAVKDIDPDAMTVDELWEIHERISQVLCSKIQSEQRKLDGHLSRL:Sequence : ========================================:BL:SWS|21->127|HVRA_RHOCA|1e-07|28.0|100/102 61: . . . * . .: 120 :RLGVTSGANQQSDDESGPKPARRPYPKVYPKYRSLKDPSLTWAGRGKQPLWLIDELKSGK:Sequence : ========================================:RP:SCP|81->128|1hnrA|8e-08|37.8|45/47|a.155.1.1 :============================================================:BL:SWS|21->127|HVRA_RHOCA|1e-07|28.0|100/102 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|87->131|PF10521|7e-04|47.4|38/272|DUF2454 121: . . + . . .: 180 :SIDDFLIRAKPSNVRKKRR :Sequence :======== :RP:SCP|81->128|1hnrA|8e-08|37.8|45/47|a.155.1.1 :======= :BL:SWS|21->127|HVRA_RHOCA|1e-07|28.0|100/102 :$$$$$$$$$$$ :RP:PFM|87->131|PF10521|7e-04|47.4|38/272|DUF2454