[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABE39967.1 rpal2 ABE39967.1 "Histone-like nucleoid-structuring protein H-NS"
MNRNRSADLIPSRWEGAVKDIDPDAMTVDELWEIHERISQVLCSKIQSEQRKLDGHLSRL
RLGVTSGANQQSDDESGPKPARRPYPKVYPKYRSLKDPSLTWAGRGKQPLWLIDELKSGK
SIDDFLIRAKPSNVRKKRR
//