[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rpal2:ABE40018.1"

            "twin-arginine translocation protein, TatA/E family"
TATA_RHOPS  "RecName: Full=Sec-independent protein translocase protein tatA/E homolog;"

OrgPattern -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111------11111111111111111111111-1111111111--11111111111111---------------------1---1--1--------------------------------111-1111-1111-1111111111111111--1-1---------111-----11--------------11---1-----------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11----------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MGSLSIWHWIVVIAVVLLLFGRGKISDLMGDVAQGIKSFKKGLQDDEKTAEKPDPVKSID:Sequence :============================================================:BL:SWS|1->79|TATA_RHOPS|5e-42|100.0|79/79 61: . . . * . .: 120 :HNAPTAAAPTRTDVGSKAV :Sequence :=================== :BL:SWS|1->79|TATA_RHOPS|5e-42|100.0|79/79