[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABE40018.1 rpal2 ABE40018.1 "twin-arginine translocation protein, TatA/E family"
MGSLSIWHWIVVIAVVLLLFGRGKISDLMGDVAQGIKSFKKGLQDDEKTAEKPDPVKSID
HNAPTAAAPTRTDVGSKAV
//