[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rpal2:ABE40026.1"

            "conserved hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--------------1-------------11---11121----------------------------------------------------------------3---------------------------------------------------------------------------------------------------------1------1--------1---11----------------------------------------------------1111-1-1--1-1--1------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSMSVTSEVSQRPRPLTGLRVGLITALVLSLLFGAMIAITFSMQNEVIAHDRDNQMGAIS:Sequence 61: . . . * . .: 120 :QAITAALDQAGRFALTQAETTARQAAVARALAAGDRAALSELAGGTYAYLKTQGVPVFGF:Sequence : XXXXXXXXXXXXXXXXXXXXXXXXXX :SEG|74->99|altqaettarqaavaralaagdraal 121: . . + . . .: 180 :HAADMTYLLRLHLPDKFGDDLTKIRPMVLAANKTGRSQVGLEIGIAGTFVRGIAVVRDGD:Sequence 181: . * . . . .: 240 :RFVGTVETGLNLEPILEQVKALTNADIAVVLSQSLADLPPRGASQNGAGETFGDLMALAS:Sequence 241: + . . . . *: 300 :TDTQLFNGLLRDGAIRLTRTRDVSAHQLQGGSAAVLVQPLIDFSGRMIGNIAAVKTFPAH:Sequence 301: . . . . + .: 360 :GAALQRTRTELIAAAMIGAILAFVAFSVLARMIAMRGQS :Sequence : XXXXXXXXXXXXXX :SEG|312->325|iaaamigailafva