[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rpal2:ABE40040.1"

            "Pyruvate dehydrogenase (lipoamide)"
            ""

OrgPattern 11----1-2121222---111---3221--22----------------------------2111---- 11214-------1-23222-2---31222221322214533435122211113352241133312262322-----------5---1-111--1--11121222232132222222222222221---------2-45522---2311111111111111111111311212111211211112212211-323333333332333333353343333355233222222242122222222222222233322-1-22-1---111111111111111111111112211111-111111111111111111211111111111---1111111-1-1111---------3------1-------21213-13--411411111222112112112144443343343-11111211231122212153223223212224121112222222222133112111111111111--11111111111111111-24A21-1-112222321111111141111-32122221--111-1-----2421--11----1----------1211-2-2----1-----212-23312221223-2----------------------1112211-11-211121211112111111111122---21--------------1-------------------------------11--12------------------------------------------1222221111--1-1---------------11111-1---3-3333121112221-----------------1-----11-111111111111---------11111----------111111-1-11111111111111-------------121 22--222-622-22222222333333322222222222222122221223223211222222211111111111111-1111111111-23222222222222224129245333322212333332A3BT3-7363221332312232342222122234223323645624223332T2224574762653432223 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MAAPKKSAAKETGQDRNSGPTKSKVPDFTKEQELHAFRDMLLIRRFEEKAGQLYGMGAIG:Sequence : TcccccccccccccGGGcccccHHHHHHHHHHHHHHHHHHHHHHHHHHTTccc:Sec Str : ==================================================:RP:SCP|11->343|1ni4A|2e-58|45.9|327/362|c.36.1.11 : ========================================================:BL:SWS|5->342|ODPA_RHIME|e-142|77.2|334/348 : $$$$$$$$$$$$$$$$$$$:RP:PFM|42->328|PF00676|4e-51|40.6|286/298|E1_dh 61: . . . * . .: 120 :GFCHLYIGQEAVVVGMQMALREGDQVITGYRDHGHMLACEMDAKGVMAELTGRRGGYSKG:Sequence :cccccTTTcHHHHHHHHHHccTTcEEEcccccHHHHHHTTccHHHHHHHHHTcTTcTTTT:Sec Str : XXXXXXXXX:SEG|112->124|grrggyskgkggs :============================================================:RP:SCP|11->343|1ni4A|2e-58|45.9|327/362|c.36.1.11 :============================================================:BL:SWS|5->342|ODPA_RHIME|e-142|77.2|334/348 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|42->328|PF00676|4e-51|40.6|286/298|E1_dh 121: . . + . . .: 180 :KGGSMHMFSMEKHFYGGHGIVGAQVSLGTGIAFANRYRDNGSVCLAYFGDGASNQGQVYE:Sequence :cccTTccccTTTTcccccccTTTHHHHHHHHHHHHHHHTccccEEEEEETTGGGcHHHHH:Sec Str :XXXX :SEG|112->124|grrggyskgkggs :============================================================:RP:SCP|11->343|1ni4A|2e-58|45.9|327/362|c.36.1.11 :============================================================:BL:SWS|5->342|ODPA_RHIME|e-142|77.2|334/348 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|42->328|PF00676|4e-51|40.6|286/298|E1_dh 181: . * . . . .: 240 :SFNMAELWKLPVVYVIENNRYAMGTSVTRSSAQTDFSKRGVSFNIPGEQVDGMDVRAVKA:Sequence :HHHHHHHTTccEEEEEEEccEETTEEGGGTccccTTGGGGGGGTcEEEEEETTcHHHHHH:Sec Str :============================================================:RP:SCP|11->343|1ni4A|2e-58|45.9|327/362|c.36.1.11 :============================================================:BL:SWS|5->342|ODPA_RHIME|e-142|77.2|334/348 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|42->328|PF00676|4e-51|40.6|286/298|E1_dh 241: + . . . . *: 300 :AGDKAVAHCRAGNGPYILEMQTYRYRGHSMSDPAKYRTREEVDKIRNDQDPIEQVRQRLL:Sequence :HHHHHHHHHHHHTccEEEEEEccccccccTTccGGGcccTHHHHcHHHHcHHHHHHHHHH:Sec Str :============================================================:RP:SCP|11->343|1ni4A|2e-58|45.9|327/362|c.36.1.11 :============================================================:BL:SWS|5->342|ODPA_RHIME|e-142|77.2|334/348 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|42->328|PF00676|4e-51|40.6|286/298|E1_dh 301: . . . . + .: 360 :GSDMTEDDLKKIDAEVRKIVNEAADFAQNDPEPDPSELYTDVYR :Sequence :HHTccHHHHHHHHHHHHHHHHHHHHHHHHcccccGGGGcTTccc :Sec Str :=========================================== :RP:SCP|11->343|1ni4A|2e-58|45.9|327/362|c.36.1.11 :========================================== :BL:SWS|5->342|ODPA_RHIME|e-142|77.2|334/348 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|42->328|PF00676|4e-51|40.6|286/298|E1_dh