[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rpal2:ABE40088.1"

            "transcriptional regulator, TetR family"
            ""

OrgPattern -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MAARCTLRPRFWPQASIAKSCGSESDTRMPRPKLHSDDDILDTAQLVLLRQGPSHFTLSD:Sequence : cTcHHccccccTTHHHHHHHHHHHHHHHTcTTTccHHH:Sec Str : =======================:RP:SCP|38->101|2i10A1|1e-11|28.1|64/69|a.4.1.9 : ==========:BL:SWS|51->134|SLMA_HAEDU|2e-05|32.1|84/202 61: . . . * . .: 120 :VAKAVGISRAALIQRFTDKATLQRRIMERMTQEVRDYFDAAPSHTGLAPLWTMLKDLIGG:Sequence :HHHHHTccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHTcccHHHHHHHHHHHHHH:Sec Str :========================================= :RP:SCP|38->101|2i10A1|1e-11|28.1|64/69|a.4.1.9 :============================================================:BL:SWS|51->134|SLMA_HAEDU|2e-05|32.1|84/202 121: . . + . . .: 180 :MGSGEDAAGHLLLYWGDTQEPALRALALERNELVRGAIERRLPSEPHNPEQASGLVQAVI:Sequence :HHHcHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHTTccccccHHHHHHHHHHHH:Sec Str : XXXXXXXXXXXXXXXX :SEG|140->155|epalralalernelvr :============== :BL:SWS|51->134|SLMA_HAEDU|2e-05|32.1|84/202 181: . * . . . .: 240 :QGACMQWLIARNGPLDAFMTEQTRQVLSVLYPGHTFE :Sequence :HTHHHHccTTccccHHHHHHHHHHHHHHcccccHc :Sec Str