[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rpal2:ABE40227.1"

            "hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKPEDFEPWVGRAVRVATVPEPVELTLIRLQRKPLFIGAEREPFSLFFEAPDDVYLLDAA:Sequence : TccTTcccccccccTTTccccHHHHHHTTTTTcEEEEEETTGGGGTccTTccccHHHHH:Sec Str 61: . . . * . .: 120 :YEFDCGRGGPYTILISQLQPRNGRRRYQAVFN :Sequence :HHHHHHH HHHHHHHTTcccc :Sec Str