[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABE40227.1 rpal2 ABE40227.1 "hypothetical protein"
MKPEDFEPWVGRAVRVATVPEPVELTLIRLQRKPLFIGAEREPFSLFFEAPDDVYLLDAA
YEFDCGRGGPYTILISQLQPRNGRRRYQAVFN
//