[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "sent8:ACF65854.1"

            "inner membrane ABC transporter permease protein YejB"
YEJB_ECOLI  "RecName: Full=Inner membrane ABC transporter permease protein yejB;"

OrgPattern 4431314255555444353232113336435212---1-----113-52-EA5-55433123313-11 -113A231222-3111111-12111611111143331348-4-33A73122369512211332184554831111422321-411111--------2--------11--122222222221111211111111121465952216932213332211------22215321----111-1-1195433991423666664564546445966643655314C521222222D6144434444444444322122222332-12111--33111112234333333311112211111112222222222222211111211111C36244434541422211111153153A-111BA531-282-5562134311----1121131FGL115754B19AAA9AA7AAK-33B3392DOM1-ePPTIJBSQILIF3-115BB96995CE1111111121122218--------------------------------1--AEBBC55666544555559955552566A5377112232343343A5AO241132231-------111211335121252222221111111211----12111111------132222212213-12114311211-114111111-11111-111111--13221------65GB2976667677766-6666677666676565665999A73345555555555555555766666663-555555545555---111111111111746333-12222124122222221212333332335562644429A91----1---245545555556588----------------12111111111111116-1111-1-21221--222-22-21111437549E977212 -----------------------------------------------------------------------------------------------------------------1--------------------------------------------2----2---------1-----------1------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MGAYLIRRLLLVIPTLWAIITINFFIVQIAPGGPVDQAIAAIEFGQGGALPGASGEGVRA:Sequence :============================================================:BL:SWS|1->364|YEJB_ECOLI|0.0|95.9|364/364 61: . . . * . .: 120 :SHAQTGVGNISDSHYRGGRGLDPEVIAEITHRYGFDKPLHERYFKMLRDYLSFDFNDSLF:Sequence :============================================================:BL:SWS|1->364|YEJB_ECOLI|0.0|95.9|364/364 121: . . + . . .: 180 :RSASVLTLIKDSLPVSITLGLWSTLIIYLVSIPLGIRKAVHNGSRFDVWSSAFIIIGYAI:Sequence : XX:SEG|179->194|aipaflfaillivffa : =======================================================:RP:SCP|126->349|3dhwA1|6e-11|15.8|202/203|f.58.1.1 :============================================================:BL:SWS|1->364|YEJB_ECOLI|0.0|95.9|364/364 181: . * . . . .: 240 :PAFLFAILLIVFFAGGSYYDIFPLRGLVSANFDTLPWYQKITDYLWHITLPVLATVIGGF:Sequence :XXXXXXXXXXXXXX :SEG|179->194|aipaflfaillivffa :============================================================:RP:SCP|126->349|3dhwA1|6e-11|15.8|202/203|f.58.1.1 :============================================================:BL:SWS|1->364|YEJB_ECOLI|0.0|95.9|364/364 : $$$$$$$$$$$$$$$$:RP:PFM|225->357|PF00528|1e-04|32.0|128/195|BPD_transp_1 241: + . . . . *: 300 :AALTMLTKNSFLDEVRKQYVVTARAKGVSEKNILWKHVFRNAMLLVIAGFPATFISMFFT:Sequence :============================================================:RP:SCP|126->349|3dhwA1|6e-11|15.8|202/203|f.58.1.1 :============================================================:BL:SWS|1->364|YEJB_ECOLI|0.0|95.9|364/364 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|225->357|PF00528|1e-04|32.0|128/195|BPD_transp_1 301: . . . . + .: 360 :GSLLIEVMFSLNGLGLLGYEATVSRDYPVMFGTLYIFTLIGLLLNILSDISYTLVDPRID:Sequence :================================================= :RP:SCP|126->349|3dhwA1|6e-11|15.8|202/203|f.58.1.1 :============================================================:BL:SWS|1->364|YEJB_ECOLI|0.0|95.9|364/364 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|225->357|PF00528|1e-04|32.0|128/195|BPD_transp_1 361: . . . * . .: 420 :FEGR :Sequence :==== :BL:SWS|1->364|YEJB_ECOLI|0.0|95.9|364/364