[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACF65854.1 sent8 ACF65854.1 "inner membrane ABC transporter permease protein YejB"
MGAYLIRRLLLVIPTLWAIITINFFIVQIAPGGPVDQAIAAIEFGQGGALPGASGEGVRA
SHAQTGVGNISDSHYRGGRGLDPEVIAEITHRYGFDKPLHERYFKMLRDYLSFDFNDSLF
RSASVLTLIKDSLPVSITLGLWSTLIIYLVSIPLGIRKAVHNGSRFDVWSSAFIIIGYAI
PAFLFAILLIVFFAGGSYYDIFPLRGLVSANFDTLPWYQKITDYLWHITLPVLATVIGGF
AALTMLTKNSFLDEVRKQYVVTARAKGVSEKNILWKHVFRNAMLLVIAGFPATFISMFFT
GSLLIEVMFSLNGLGLLGYEATVSRDYPVMFGTLYIFTLIGLLLNILSDISYTLVDPRID
FEGR
//