[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "sent8:ACF65871.1"

            "putative membrane protein"
YEDE_SALTY  "RecName: Full=UPF0394 inner membrane protein yedE;"

OrgPattern ------------------1-----------1-------------------------------11---- -----------------------------------------------------------------11-1-------------1------------------------------------------------------------------111---------------1--------------------11-1-----------------1--------111-1---------------------------------------------1-------------------------------------------------------11--2222222-2-----11-1-2---2------------41111-------------------------------------------------1-------------11--------1111------------------------------------------------------------------------1----------------------------------------------11------------------------------------1--1-111111-1-------1-------------------111--1111--11--------1-1------11---1-1111111111-1111111111111-11--1111----1111111111111111111111111---11111111111------------------111------------------------1111-1-1-11-11111--------------------------------------------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSWQHFKQTWLIKFWAPAPAVIAAGILSTYYFGITGTFWAVTGEFTRWGGQILQLFGVHA:Sequence :============================================================:BL:SWS|1->401|YEDE_SALTY|0.0|95.3|401/401 61: . . . * . .: 120 :EQWGYYKLIHLEGTPLTRIDGMMILGMFGGCFAAALWANNVKLRMPRSRIRIVQAVVGGM:Sequence :============================================================:BL:SWS|1->401|YEDE_SALTY|0.0|95.3|401/401 121: . . + . . .: 180 :IAGFGARLAMGCNLAAFFTGIPQFSLHAWFFALATAIGSWFGARFTLLPIFRIPVKMQKV:Sequence :============================================================:BL:SWS|1->401|YEDE_SALTY|0.0|95.3|401/401 181: . * . . . .: 240 :SAASPLTQKPDQARRRFRLGMLVFIGMIGWALLTAMHQPKLGLAMLFGIGFGLLIERAQI:Sequence :============================================================:BL:SWS|1->401|YEDE_SALTY|0.0|95.3|401/401 241: + . . . . *: 300 :CFTSAFRDLWISGRAHMAKAIIFGMAVSAIGIFSYVQLGVAPKIMWAGPNAVIGGLLFGF:Sequence : XXXXXXXXXX:SEG|291->307|aviggllfgfgivlagg :============================================================:BL:SWS|1->401|YEDE_SALTY|0.0|95.3|401/401 301: . . . . + .: 360 :GIVLAGGCETGWMYRAVEGQVHYWWVGLGNVIGSTILAYYWDDFAPALATSWDKVNLLNT:Sequence :XXXXXXX :SEG|291->307|aviggllfgfgivlagg :============================================================:BL:SWS|1->401|YEDE_SALTY|0.0|95.3|401/401 361: . . . * . .: 420 :FGPLGGLLVTYLLLFTALMLIIGWEKRFFRRAGLTPAKESV :Sequence : XXXXXXXXXXXXXXXXXXXXXX :SEG|362->383|gplggllvtylllftalmliig :========================================= :BL:SWS|1->401|YEDE_SALTY|0.0|95.3|401/401