[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACF65871.1 sent8 ACF65871.1 "putative membrane protein"
MSWQHFKQTWLIKFWAPAPAVIAAGILSTYYFGITGTFWAVTGEFTRWGGQILQLFGVHA
EQWGYYKLIHLEGTPLTRIDGMMILGMFGGCFAAALWANNVKLRMPRSRIRIVQAVVGGM
IAGFGARLAMGCNLAAFFTGIPQFSLHAWFFALATAIGSWFGARFTLLPIFRIPVKMQKV
SAASPLTQKPDQARRRFRLGMLVFIGMIGWALLTAMHQPKLGLAMLFGIGFGLLIERAQI
CFTSAFRDLWISGRAHMAKAIIFGMAVSAIGIFSYVQLGVAPKIMWAGPNAVIGGLLFGF
GIVLAGGCETGWMYRAVEGQVHYWWVGLGNVIGSTILAYYWDDFAPALATSWDKVNLLNT
FGPLGGLLVTYLLLFTALMLIIGWEKRFFRRAGLTPAKESV
//