[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "sent8:ACF65897.1"

            "conserved domain protein"
            ""

OrgPattern -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-----------------------------------------3122-222222222-22-222222222222222222234322---322333333333333322222222--1----------------------------------------------------------------1--------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKKLFICSGLGMMFFMLAGCTTNYVMTTKNGQTIVTQGKPQLDKETGMTSYTDQEGNQRE:Sequence : ccEEEEEETTccEEEEEcccEEcTTTcEEEEEcTTccEEE:Sec Str : ======================================:RP:SCP|23->73|2ra2A1|5e-16|47.1|51/53|b.38.1.6 :============================================================:BL:SWS|1->71|YGDR_SHIFL|3e-16|45.1|71/72 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|23->72|PF06004|2e-11|60.0|50/50|DUF903 61: . . . * . .: 120 :INSNDVAQLIKAD :Sequence :EcGGGEEEEEEcc :Sec Str :============= :RP:SCP|23->73|2ra2A1|5e-16|47.1|51/53|b.38.1.6 :=========== :BL:SWS|1->71|YGDR_SHIFL|3e-16|45.1|71/72 :$$$$$$$$$$$$ :RP:PFM|23->72|PF06004|2e-11|60.0|50/50|DUF903