[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACF65897.1 sent8 ACF65897.1 "conserved domain protein"
MKKLFICSGLGMMFFMLAGCTTNYVMTTKNGQTIVTQGKPQLDKETGMTSYTDQEGNQRE
INSNDVAQLIKAD
//