[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "sent8:ACF65921.1"

            "cytochrome bd-II oxidase subunit 1"
            ""

OrgPattern -------------------------421-1--------------------11-----1---222---- 11111-11111--111111-11--1211111-11112111111111111111111-11--11111122112--------111-11-111111-111----11-1-1-1-111111111111111111-11-11-11--------2-1111---1111-------11141---------------1------12233333333233333312222233312111111111112-111111111111111111111-1-22-11-1111122-1-1111111111---------------------------------------1----------------------------2--1-11-1----11--------111111-----122111-11113111111111111-33234133211-3111-111111133-1-11111111--2222222221111-31------------11111111111111-1---12-1333233332333222255543433124542222-1112-1---11111-11--2-211----------12--1211111121111121211111122221113111-111111--1--------111-11221311211121222211221221121211--1-11-------23122322222222222-2222222222222222222332223233333333333333232222222221-211111111111---12222122221111311111111111111122222121112111212222112112111211112121-111133333122112234344333-------------------------------------------------------------11 -------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------1-------------1---------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MEFDAFFLARLQFAFTVSFHIIFPAITIGLASYLVVLEGLWLKTRNPVWRSLYQFWLKIF:Sequence : =====================================================:BL:SWS|8->437|CYDA_BACSU|2e-80|36.4|429/468 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|8->436|PF01654|e-108|49.6|427/432|Bac_Ubq_Cox 61: . . . * . .: 120 :AVNFGMGVVSGLVMAYQFGTNWSGFSQFAGSITGPLLTYEVLTAFFLEAGFLGVMLFGWN:Sequence :============================================================:BL:SWS|8->437|CYDA_BACSU|2e-80|36.4|429/468 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|8->436|PF01654|e-108|49.6|427/432|Bac_Ubq_Cox 121: . . + . . .: 180 :KVGPGLHFLSTCMVALGTLMSTFWILASNSWMHTPQGFEIHNGQVVPVDWFAVIFNPSFP:Sequence :============================================================:BL:SWS|8->437|CYDA_BACSU|2e-80|36.4|429/468 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|8->436|PF01654|e-108|49.6|427/432|Bac_Ubq_Cox 181: . * . . . .: 240 :YRLLHMSVAAFLSSAMFVGASAAWHLLKGNDTPAIRRMFSMALWMAVVVAPVQALIGDMH:Sequence :============================================================:BL:SWS|8->437|CYDA_BACSU|2e-80|36.4|429/468 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|8->436|PF01654|e-108|49.6|427/432|Bac_Ubq_Cox 241: + . . . . *: 300 :GLNTLKHQPVKIAAIEGHWENTPGEPTPLTLVGWPDMEAERTRYALEIPALGSLILTHSL:Sequence :============================================================:BL:SWS|8->437|CYDA_BACSU|2e-80|36.4|429/468 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|8->436|PF01654|e-108|49.6|427/432|Bac_Ubq_Cox 301: . . . . + .: 360 :DKQVPALKDYPKEDRPNSTVVFWSFRLMVGMGVLMIFLGLASLWLRYRRRLYHSRPFMHF:Sequence :============================================================:BL:SWS|8->437|CYDA_BACSU|2e-80|36.4|429/468 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|8->436|PF01654|e-108|49.6|427/432|Bac_Ubq_Cox 361: . . . * . .: 420 :ALWMGPSGLIAILAGWVTTEVGRQPWVVYGLLRTRDAVSAHSTLQMSISLLAFFVVYSLV:Sequence :============================================================:BL:SWS|8->437|CYDA_BACSU|2e-80|36.4|429/468 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|8->436|PF01654|e-108|49.6|427/432|Bac_Ubq_Cox 421: . . + . . .: 480 :FGVGYIYMIRLIQKGPQPAETPTAETDGRPARPISAVGESLEQEKRE :Sequence :================= :BL:SWS|8->437|CYDA_BACSU|2e-80|36.4|429/468 :$$$$$$$$$$$$$$$$ :RP:PFM|8->436|PF01654|e-108|49.6|427/432|Bac_Ubq_Cox