[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACF65921.1 sent8 ACF65921.1 "cytochrome bd-II oxidase subunit 1"
MEFDAFFLARLQFAFTVSFHIIFPAITIGLASYLVVLEGLWLKTRNPVWRSLYQFWLKIF
AVNFGMGVVSGLVMAYQFGTNWSGFSQFAGSITGPLLTYEVLTAFFLEAGFLGVMLFGWN
KVGPGLHFLSTCMVALGTLMSTFWILASNSWMHTPQGFEIHNGQVVPVDWFAVIFNPSFP
YRLLHMSVAAFLSSAMFVGASAAWHLLKGNDTPAIRRMFSMALWMAVVVAPVQALIGDMH
GLNTLKHQPVKIAAIEGHWENTPGEPTPLTLVGWPDMEAERTRYALEIPALGSLILTHSL
DKQVPALKDYPKEDRPNSTVVFWSFRLMVGMGVLMIFLGLASLWLRYRRRLYHSRPFMHF
ALWMGPSGLIAILAGWVTTEVGRQPWVVYGLLRTRDAVSAHSTLQMSISLLAFFVVYSLV
FGVGYIYMIRLIQKGPQPAETPTAETDGRPARPISAVGESLEQEKRE
//