[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "sent8:ACF65947.1"

            "hydrogenase-1 operon protein HyaF2"
            ""

OrgPattern ----------------1------1------------1----------1----------------1--- -------------------------------------------------------------------------------------111---1------------------------------------12----------------11-----11-----1----1---1---1--------------1------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------2-322---222-2------------------------------------22-----22222-----------2------1------------------------------------------------------1-------2---22------1----2------------------------22-----------------1--11--------1--------------------------------------------------------------2--------1--121-2221222222-2222222221222222222111-----3323333332233333-2213222---------------------------1-----------------------------2------------------------------------------------------------------------------------------------------11---111-11-- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------121---------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MNHSRTIPVVNIAGPGSQPEEEDFNFLPIPAGINLPLTPVLPEQALPAELRVARHILTTL:Sequence : :Sec Str : ==========================================================:BL:SWS|3->282|HOXQ_RALEH|6e-44|39.6|273/282 61: . . . * . .: 120 :IRDMDNPVATLPFPLSYKLNATEQQNSGLLDQLLGEGEISARVLLSDGKEQRIQETVFTG:Sequence : :Sec Str :============================================================:BL:SWS|3->282|HOXQ_RALEH|6e-44|39.6|273/282 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|72->147|PF04809|9e-14|48.1|73/108|HupH_C 121: . . + . . .: 180 :VWRVREYNADQQRVADEIIIGPIPESIWQTHPQPPITPELPPQPAGLMNGAFIAHEIAER:Sequence : :Sec Str : XXXXXXXXXXXXX :SEG|152->164|pqppitpelppqp : ================:RP:SCP|165->278|1vhnA|6e-05|18.8|101/305|c.1.4.1 :============================================================:BL:SWS|3->282|HOXQ_RALEH|6e-44|39.6|273/282 :$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|72->147|PF04809|9e-14|48.1|73/108|HupH_C 181: . * . . . .: 240 :VKQPVKEPHIINLTLLPVNDADREYLDHFLGEGCSAIFSRGYGKCRIVSTHFPGVWRVNY:Sequence : :Sec Str :============================================================:RP:SCP|165->278|1vhnA|6e-05|18.8|101/305|c.1.4.1 :============================================================:BL:SWS|3->282|HOXQ_RALEH|6e-44|39.6|273/282 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|182->271|PF04809|1e-25|53.3|90/108|HupH_C 241: + . . . . *: 300 :FNDMNTLLQDMIEIADIPDIAVAGIDDIEDAYAGLKNTLEWLKEYPVTENEPVVRMECKV:Sequence : cccccccccccccccccEEEETT:Sec Str :====================================== :RP:SCP|165->278|1vhnA|6e-05|18.8|101/305|c.1.4.1 : =====:RP:SCP|296->346|1b13A|4e-13|37.3|51/54|g.41.5.1 :========================================== :BL:SWS|3->282|HOXQ_RALEH|6e-44|39.6|273/282 : =====:BL:SWS|296->345|RUBR_AZOVI|6e-17|60.0|50/72 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|182->271|PF04809|1e-25|53.3|90/108|HupH_C : $$$$$$:RP:PFM|295->341|PF00301|3e-11|57.4|47/47|Rubredoxin 301: . . . . + .: 360 :CWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVCETSKSGFMVIDEGNNSCKD :Sequence :TccEEETTTccGGGTccTTccGGGccTTcccTTTcccGGGEEEccc :Sec Str :============================================== :RP:SCP|296->346|1b13A|4e-13|37.3|51/54|g.41.5.1 :============================================= :BL:SWS|296->345|RUBR_AZOVI|6e-17|60.0|50/72 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|295->341|PF00301|3e-11|57.4|47/47|Rubredoxin