[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACF65947.1 sent8 ACF65947.1 "hydrogenase-1 operon protein HyaF2"
MNHSRTIPVVNIAGPGSQPEEEDFNFLPIPAGINLPLTPVLPEQALPAELRVARHILTTL
IRDMDNPVATLPFPLSYKLNATEQQNSGLLDQLLGEGEISARVLLSDGKEQRIQETVFTG
VWRVREYNADQQRVADEIIIGPIPESIWQTHPQPPITPELPPQPAGLMNGAFIAHEIAER
VKQPVKEPHIINLTLLPVNDADREYLDHFLGEGCSAIFSRGYGKCRIVSTHFPGVWRVNY
FNDMNTLLQDMIEIADIPDIAVAGIDDIEDAYAGLKNTLEWLKEYPVTENEPVVRMECKV
CWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVCETSKSGFMVIDEGNNSCKD
//