[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "sent8:ACF65952.1"

            "conserved hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-11111----1----111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MNASGASVRHINSETCMTTCYSQIPSGDCQEEAGFETGASVVVKISERGLILIAETDEVR:Sequence : ==========================:BL:SWS|35->84|GATB1_CLOAB|7e-04|44.0|50/476 61: . . . * . .: 120 :DLRKELYQVKKSMKHIKAGVNNVVNGN :Sequence :======================== :BL:SWS|35->84|GATB1_CLOAB|7e-04|44.0|50/476