[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACF65952.1 sent8 ACF65952.1 "conserved hypothetical protein"
MNASGASVRHINSETCMTTCYSQIPSGDCQEEAGFETGASVVVKISERGLILIAETDEVR
DLRKELYQVKKSMKHIKAGVNNVVNGN
//